DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and Tic62

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_188519.2 Gene:Tic62 / 821422 AraportID:AT3G18890 Length:641 Species:Arabidopsis thaliana


Alignment Length:226 Identity:46/226 - (20%)
Similarity:80/226 - (35%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKS-----------------KVELVKG 51
            :.:.|.||..|...|...|:.|..|:...||.:......:|                 |:|:|:.
plant    84 VFVAGATGKVGSRTVRELLKLGFRVRAGVRSAQRAGSLVQSVKEMKLQNTDEGTQPVEKLEIVEC 148

  Fly    52 DVTNYEDVQRVIEGVDAVAVILGTRNKLEATTELS----------RGTENLIKAMKEAKLTKFSI 106
            |:...:.:|..:.....:...:|...|     |:|          ..|:||:.|...||:..|.:
plant   149 DLEKKDSIQPALGNASVIICCIGASEK-----EISDITGPYRIDYLATKNLVDAATSAKVNNFIL 208

  Fly   107 VMS------SFLLRPLNEVPTVFHRLNEEHQRMLDLTKACDLDWIAILPPHIADEPATAYTVLH- 164
            |.|      .|....||....|.....:..:.:::    ..|:: ||:.|...:.|..||...| 
plant   209 VTSLGTNKFGFPAAILNLFWGVLCWKRKAEEALIE----SGLNY-AIVRPGGMERPTDAYKETHN 268

  Fly   165 ------DEAPGRLVSKYDLGKFIIDSLEQPE 189
                  |...|..||...:.:.:....:.|:
plant   269 LTLALDDTLFGGQVSNLQVAELLACMAKNPQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 46/226 (20%)
WcaG 3..>110 CDD:223528 29/138 (21%)
Tic62NP_188519.2 PLN03209 1..639 CDD:178748 46/226 (20%)
SDR_a5 84..312 CDD:187554 46/226 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I4578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.