DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and AT2G37660

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_565868.1 Gene:AT2G37660 / 818343 AraportID:AT2G37660 Length:325 Species:Arabidopsis thaliana


Alignment Length:254 Identity:46/254 - (18%)
Similarity:87/254 - (34%) Gaps:82/254 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTV----------PERFKSKVELVKGDVTNYED 58
            :.:.|..|.||:....         ||..|||:.|          .|:...:.|:..||:.:...
plant    79 VLVTGAGGRTGQIVYK---------KLKERSEQFVARGLVRTKESKEKINGEDEVFIGDIRDTAS 134

  Fly    59 VQRVIEGVDAVAVILGTRNKLEATTELSR--------------------GTENLIKAMKEAKLTK 103
            :...:||:||:.::.....:::...:.|:                    |.:|.|.|.|.|.:.:
plant   135 IAPAVEGIDALVILTSAVPQMKPGFDPSKGGRPEFFFDDGAYPEQVDWIGQKNQIDAAKAAGVKQ 199

  Fly   104 FSIVMS---SFLLRPLNEVPTVFHRLNEEHQRMLDLTKACDLDWIAILPPHIADEPATAYTV--- 162
            ..:|.|   :.:..|||.:                 ..|..|.|......::||. ...||:   
plant   200 IVLVGSMGGTNINHPLNSI-----------------GNANILVWKRKAEQYLADS-GIPYTIIRA 246

  Fly   163 --LHDEAPG-----------------RLVSKYDLGKFIIDSLEQPEHYRKVCGIGKSPK 202
              |.|:..|                 |.:::.|:.:..:.:|:..|...|...:...|:
plant   247 GGLQDKDGGIRELLVGKDDELLETETRTIARADVAEVCVQALQLEEAKFKALDLASKPE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 45/247 (18%)
WcaG 3..>110 CDD:223528 27/138 (20%)
AT2G37660NP_565868.1 SDR_a5 78..300 CDD:187554 45/247 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I4578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2659
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.