DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and AT2G34460

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_565789.2 Gene:AT2G34460 / 818009 AraportID:AT2G34460 Length:280 Species:Arabidopsis thaliana


Alignment Length:227 Identity:58/227 - (25%)
Similarity:100/227 - (44%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QRIAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKS--KVELVKGDVTNYEDVQRVIE 64
            :::.:.|.||.||:..|:..|.:|.:||...|..:.....||.  .:::|:.|||...|....:.
plant    47 KKVFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTSFKDDPSLQIVRADVTEGPDKLAEVI 111

  Fly    65 GVDAVAVILGT--RNKLEATTEL---SRGTENLIKAMKEAKLTKFSIVMSSF--------LLRP- 115
            |.|:.|||..|  |...:..|..   :.||.||:.|.::..:.||.:|.|..        :|.| 
plant   112 GDDSQAVICATGFRPGFDIFTPWKVDNFGTVNLVDACRKQGVEKFVLVSSILVNGAAMGQILNPA 176

  Fly   116 ---LNEVP-TVFHRLNEEHQRMLDLTKACDLDWIAILPPHIADEPATAYTVLHDE---APGRLVS 173
               ||... |:..:|..|     ...|...:::..:.|..:.::|.|...|:..|   ..|. :|
plant   177 YLFLNLFGLTLVAKLQAE-----KYIKKSGINYTIVRPGGLKNDPPTGNVVMEPEDTLYEGS-IS 235

  Fly   174 KYDLGKFIIDSLEQPEHYRKVCGI---GKSPK 202
            :..:.:..:::|.|.|...||..|   .::||
plant   236 RDLVAEVAVEALLQEESSFKVVEIVARAEAPK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 55/216 (25%)
WcaG 3..>110 CDD:223528 34/113 (30%)
AT2G34460NP_565789.2 PLN00141 34..280 CDD:215072 58/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I4578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2659
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102768
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.830

Return to query results.
Submit another query.