DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9471 and LOC100496714

DIOPT Version :9

Sequence 1:NP_001097729.1 Gene:CG9471 / 41197 FlyBaseID:FBgn0037749 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_002941541.1 Gene:LOC100496714 / 100496714 -ID:- Length:221 Species:Xenopus tropicalis


Alignment Length:215 Identity:54/215 - (25%)
Similarity:105/215 - (48%) Gaps:25/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKSKVELVKGDVTNYEDVQRVIEGVD 67
            :::|:|.||.||...:..|||:|..||.|.|:...:..:.:: :::|:.::.:.|.::...:|.|
 Frog     2 KLSILGATGQTGLFLISQALQQGHEVKALVRNVSKITIQHQN-LKVVEANIFSSESLEEHFKGQD 65

  Fly    68 AVAVILGTRNKL-EATTELSRGTENLIKAMKEAKLTKF-----------SIVMSSFLLRPLNEVP 120
            .|...||.:.|| .:.:..|...:.::.||::|.:.:.           |.:.|||.:|.| .:|
 Frog    66 TVMSCLGFQYKLFSSISGYSDSMKAIVTAMRQAGVKRMVTMTSWYTGPGSGINSSFFIRNL-LIP 129

  Fly   121 TVFHRLNEEHQRMLDLTKAC-DLDWIAILPPHIADEPATAYTVLHDE---APG-------RLVSK 174
            .:...|...::....|...| ||:|..:.||.:.:.|||...::..|   .||       ..|::
 Frog   130 LIKSVLTNMYEMEQYLEMECSDLNWTVVRPPGLQNNPATDKEIMTSEGFFVPGDDGYPVTNTVAR 194

  Fly   175 YDLGKFIIDSLEQPEHYRKV 194
            .|:.:|::..|...:..||:
 Frog   195 GDVARFMLSVLNDEKWTRKI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9471NP_001097729.1 BVR-B_like_SDR_a 3..197 CDD:187555 54/215 (25%)
WcaG 3..>110 CDD:223528 28/118 (24%)
LOC100496714XP_002941541.1 BVR-B_like_SDR_a 2..217 CDD:187555 54/215 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50219
OrthoDB 1 1.010 - - D1166292at2759
OrthoFinder 1 1.000 - - FOG0006648
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.