DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa80 and Naa80

DIOPT Version :9

Sequence 1:NP_001014612.1 Gene:Naa80 / 41195 FlyBaseID:FBgn0037747 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_062724.1 Gene:Naa80 / 56441 MGIID:1888902 Length:314 Species:Mus musculus


Alignment Length:132 Identity:49/132 - (37%)
Similarity:74/132 - (56%) Gaps:6/132 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PIHNYPELMKDTCALINAEWPRSETARMRSLEASCDSLPCSLVL----TTEGMCR-VIAHLKLSP 86
            |:|..||||.....|||.:||||..:|:.||..|.|:.|..|:|    .|.|... |:.|.:||.
Mouse    92 PVHCRPELMSACADLINDQWPRSRASRLHSLGQSSDAFPLCLMLLSPQPTPGAAPVVVGHARLSR 156

  Fly    87 INSKKKACFVESVVVDKRHRGQGFGKLIMKFAEDYCRVVLDLKTIYLSTIDQDGFYERIGYEYCA 151
            :..:..:..||:|||.:..||:|||:.:|:..|.:.| ....:.::|:|.||..||..:||:...
Mouse   157 VLDQPHSLLVETVVVARPLRGRGFGRRLMEGLEAFAR-ARGFRRLHLTTHDQLYFYAHLGYQLGE 220

  Fly   152 PI 153
            |:
Mouse   221 PV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa80NP_001014612.1 Acetyltransf_1 35..147 CDD:395465 41/116 (35%)
Naa80NP_062724.1 Substrate binding. /evidence=ECO:0000250|UniProtKB:Q59DX8 118..121 1/2 (50%)
NAT_SF 148..203 CDD:173926 17/54 (31%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q59DX8 169..171 0/1 (0%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q59DX8 177..182 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846148
Domainoid 1 1.000 47 1.000 Domainoid score I11999
eggNOG 1 0.900 - - E1_KOG3397
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008051
OrthoInspector 1 1.000 - - oto92371
orthoMCL 1 0.900 - - OOG6_107957
Panther 1 1.100 - - LDO PTHR13538
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6965
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.700

Return to query results.
Submit another query.