DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa80 and C56G2.15

DIOPT Version :9

Sequence 1:NP_001014612.1 Gene:Naa80 / 41195 FlyBaseID:FBgn0037747 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_498391.1 Gene:C56G2.15 / 175899 WormBaseID:WBGene00016983 Length:217 Species:Caenorhabditis elegans


Alignment Length:159 Identity:52/159 - (32%)
Similarity:86/159 - (54%) Gaps:8/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VPIHNYPELMKDTCALINAEWPRSETARMRSLEASC-DSLPCSLVLTTEGMCRVIAHLKLSPINS 89
            |.:::..:|:|::...:|:|||||:.:|..|.:.|| .|.|.|.:|..:....::.|.:::.:.:
 Worm     7 VTLYDRQDLLKESMTFLNSEWPRSDGSREHSQKKSCRQSPPMSFLLLNKENDEILGHSRITHLPN 71

  Fly    90 KKKACFVESVVVDKRHRGQGFGKLIMKFAEDYCRVVLDLKTIYLSTIDQDGFYERIGYEYCAPIT 154
            :..|.::|||::.|..||.|.||.:||..|.: .........||||.||..|||.:|||.|.||.
 Worm    72 RDHALWIESVMIKKDQRGLGLGKFLMKSTEKW-MTEKGFNEAYLSTDDQCRFYESLGYEKCDPIV 135

  Fly   155 MYGPRHCELPSL---QNA---KKKYMKKV 177
            ......|..|::   |||   ...::.|:
 Worm   136 HSTTATCIFPAMNHFQNAAASNPSFLSKI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa80NP_001014612.1 Acetyltransf_1 35..147 CDD:395465 38/112 (34%)
C56G2.15NP_498391.1 Acetyltransf_1 23..128 CDD:366181 37/105 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164153
Domainoid 1 1.000 67 1.000 Domainoid score I6497
eggNOG 1 0.900 - - E1_KOG3397
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3674
Isobase 1 0.950 - 0 Normalized mean entropy S11788
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008051
OrthoInspector 1 1.000 - - oto17941
orthoMCL 1 0.900 - - OOG6_107957
Panther 1 1.100 - - LDO PTHR13538
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3642
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.