DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa80 and Naa80

DIOPT Version :9

Sequence 1:NP_001014612.1 Gene:Naa80 / 41195 FlyBaseID:FBgn0037747 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001291705.1 Gene:Naa80 / 100910872 RGDID:6496422 Length:312 Species:Rattus norvegicus


Alignment Length:180 Identity:56/180 - (31%)
Similarity:87/180 - (48%) Gaps:22/180 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PFNVSGSP--------------FNVVPIHNYPELMKDTCALINAEWPRSETARMRSLEASCDSLP 65
            |..::|.|              ..:.|:|..||||.....|||.:||||..:|:.||..|.|:.|
  Rat    66 PAELTGDPQHQAKESLVPKLAELTLEPVHCRPELMSACADLINDQWPRSRASRLHSLGQSSDAFP 130

  Fly    66 CSLVL----TTEGMCR-VIAHLKLSPINSKKKACFVESVVVDKRHRGQGFGKLIMKFAEDYCRVV 125
            ..|:|    .|.|... |:.|.:||.:.....:..||:|||.:..||:|||:.:|:..|.:.| .
  Rat   131 LCLMLLSPQPTPGAAPIVVGHARLSRVLDHPHSLLVETVVVARALRGRGFGRRLMEGLEAFAR-A 194

  Fly   126 LDLKTIYLSTIDQDGFYERIGYEYCAPITMYGPRHCELPSLQNAKKKYMK 175
            ...:.::|:|.||..||..:||:...|:......:..||:  |..:.:.|
  Rat   195 RGFQRLHLTTHDQLYFYAHLGYQLGEPVQGLAFTNRRLPT--NVLRAFSK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa80NP_001014612.1 Acetyltransf_1 35..147 CDD:395465 41/116 (35%)
Naa80NP_001291705.1 Acetyltransf_1 <148..216 CDD:395465 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.