DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa80 and naa80

DIOPT Version :9

Sequence 1:NP_001014612.1 Gene:Naa80 / 41195 FlyBaseID:FBgn0037747 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_002935682.2 Gene:naa80 / 100498314 XenbaseID:XB-GENE-987129 Length:353 Species:Xenopus tropicalis


Alignment Length:149 Identity:54/149 - (36%)
Similarity:77/149 - (51%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VVPIHNYPELMKDTCALINAEWPRSETARMRSLEASCDSLPCSLVLTTEGMCRVIAHLKLSPINS 89
            :||:|..|:|:.....|:|..|.||..|||.|||.|||..|..|.|.:......:.|::|..:..
 Frog    17 LVPLHTCPKLIPSCAELLNETWQRSLGARMHSLERSCDDFPVCLALISSPDGPALGHVRLCKVIG 81

  Fly    90 KKKACFVESVVVDKRHRGQGFGKLIMKFAEDYCRVVLDLKTIYLSTIDQDGFYERIGYEYCAPIT 154
            ...:.|||||||....||:|:|:.:|:..|.|.| ....:.::|:|.|:..||..:||:...||.
 Frog    82 SHDSLFVESVVVSTELRGKGYGRKLMEATEKYAR-SRGFRNLHLTTHDKQDFYHHLGYQLSEPIQ 145

  Fly   155 MYGPRHCELPS--LQNAKK 171
            ..|.....||.  ||...|
 Frog   146 SMGTLGTLLPMGILQRLSK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa80NP_001014612.1 Acetyltransf_1 35..147 CDD:395465 39/111 (35%)
naa80XP_002935682.2 Acetyltransf_1 27..138 CDD:395465 39/111 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11584
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1518613at2759
OrthoFinder 1 1.000 - - FOG0008051
OrthoInspector 1 1.000 - - oto102680
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6965
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.