DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and CG3281

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:594 Identity:117/594 - (19%)
Similarity:198/594 - (33%) Gaps:179/594 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LEVHNSKVEVNTDDK--DLRR---TILKDLHQLTIGEPDQNSPLR-------------PFDKSIL 106
            ||.|.:.:.|:.:.|  ||:.   .:|:.:.:|.....|.|.|:.             .|...:.
  Fly    19 LETHETNLYVHDEIKYNDLKLELWQLLEAVSKLKWTWTDPNLPMHLCQNCARRLIGAYEFIVEVE 83

  Fly   107 NRHNALCSTPSKGNISTETQTPQIMESIDLTQIDD-------------KENTQPEGCGGDNSTLS 158
            |.|..|.:...:..::.:.....: :.::|...||             :::.:.|...||....:
  Fly    84 NAHETLQNLFEQQEVAAKPDEVHV-DVVELIDQDDVVSMAQYLSTSFAEQHVEMEEKYGDQDCSA 147

  Fly   159 SSVDVTANTVKANTLKTGDATMDNVSLQEAAKTPAPSQVYPLSANVVLENITEVS---NEGVSML 220
            .:.||....:.|:. ...|...|:..|:     |.|.::    .|..|...:::.   |...:.:
  Fly   148 FTSDVGEEPLYASE-DRDDEPEDSFQLK-----PRPDEI----ENRELSRPSQLGSRLNHSANFI 202

  Fly   221 VSPAGAEKEVAHVNEVVNEVSELIAKALKISADSVKPATSKLKVEA-GK------------KRQS 272
            ...|...:..|....:....|:    |.|::||   .|..||..|: |.            |||.
  Fly   203 YKCAVCPRVFAKSESLTRHFSQ----AHKLTAD---VAAMKLANESCGTGLLTCEHCPRTFKRQD 260

  Fly   273 MSSTYSGAALPRPRRSYLPTTTAETRTYSFKQRMSVVVKTTLNSPARKRSVGGGVSLSRRSC--- 334
                    .|.|..:::.|...|            :..:.|.::.||||..      .||.|   
  Fly   261 --------TLRRHMQAFHPDAIA------------LEPEETTDNSARKRIA------KRRDCPHC 299

  Fly   335 ---LPVSKLTKSSIRKSLAVTSVRSPEKIASKPAKTSTKSIPEKVFSCKNCSTTFRVKSLLDVHM 396
               .|||.|| ..||:...                       :..:.|..|...|.....|.:||
  Fly   300 GLSFPVSSLT-IHIRRHTG-----------------------DNPYKCDQCEKAFPRSQDLSLHM 340

  Fly   397 RMHD---PVDNGANTLKRLNSNPVA------AGVSKNRCKFCDKNFALERALHIHLMQNCDKIP- 451
            |.|.   |.:....:.|.::.|.:|      .|.....||.|.|:|.....|.||:.::..:.| 
  Fly   341 RQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPY 405

  Fly   452 -----------PSEKRKLEFTELNHEKKAQLPKI--GGTSGIN---HPMTMPQKPQQRISTIPKL 500
                       .|.      ..::..:|..|..:  |.....|   .|....:..|:|...|.::
  Fly   406 QCGVCGESFVCGSH------LNIHRNRKGHLIAVIPGNEVEANFAADPYVNARVNQRRSEDIERM 464

  Fly   501 APSQGTQSMAPPSVKKIPKNVAHAGVYRTPTKTVP-----CHICKQSFRSILEFTNHSLTVHGNN 560
                        .:::||:|.....:...|...||     |.:|:|.|:|     ...||||.| 
  Fly   465 ------------RLQRIPENQLQQRLENLPKPDVPAMCYKCGVCEQKFKS-----GALLTVHRN- 511

  Fly   561 QLKKMTGRE 569
               ||:..|
  Fly   512 ---KMSHYE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 7/21 (33%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 426..444 CDD:275368 8/17 (47%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 16/72 (22%)
C2H2 Zn finger 205..226 CDD:275368 3/24 (13%)
C2H2 Zn finger 249..266 CDD:275368 5/24 (21%)
COG5048 <294..>391 CDD:227381 27/120 (23%)
C2H2 Zn finger 296..315 CDD:275368 8/19 (42%)
zf-H2C2_2 307..330 CDD:290200 6/46 (13%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 6/22 (27%)
C2H2 Zn finger 351..371 CDD:275368 3/19 (16%)
zf-H2C2_2 364..388 CDD:290200 7/23 (30%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
zf-H2C2_2 391..416 CDD:290200 4/24 (17%)
C2H2 Zn finger 407..424 CDD:275368 1/22 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.