DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and CG6791

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:691 Identity:125/691 - (18%)
Similarity:208/691 - (30%) Gaps:233/691 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DTLSNAKWQSALVTQNSQFLEVHNSKVEVNTDDKDLRRTILKDLHQLTIGEPDQNSPLRPFDKSI 105
            |..::|:|     :|:.:|:..:.|:..:|....|::...|:....:|   |:....||....|.
  Fly   360 DCDTHAQW-----SQHIEFVHDYVSRRGLNFRSVDMQMQCLECKKIVT---PNTIKSLRAHKFSH 416

  Fly   106 LNRHNAL-CSTPSKGNISTETQTPQIMES--IDLTQIDDKENTQPEG-------CGGDNSTLSSS 160
            |::...| |....||....:.....:::.  :|....:|.|....:.       |.|||      
  Fly   417 LSQPEWLRCKLCYKGYTDHQEIIRHLLQQHHMDTLMSEDAEEEDGDAPSAIEDECDGDN------ 475

  Fly   161 VDVTANTVKANTLKTGDATMDNVSLQEAAK--TPAPSQVYPLSANVVLENITEVSNEGVSMLVSP 223
                           |:...:...|.|.:.  ..||.:...:|::.:.|       ..:..|...
  Fly   476 ---------------GNGEGNGAPLDEDSPYFEDAPRRGGRISSDDIFE-------PHIDYLCPQ 518

  Fly   224 AGAE-KEVAHVNEVVNEVSELIAKALKISADSVKPATSKLKVEAGKKRQ--------SMSSTYSG 279
            .|.| .|..|....|            :.|.|:.. .|||..|...:||        .:::.|..
  Fly   519 CGKEFIEKKHWRTHV------------VMAHSMND-LSKLNFEMINERQLKCTECDKIITNAYGI 570

  Fly   280 AALPRPRRSYLP-TTTAETRT--YSFKQRMSVVVK-TTLNSPARKRSVGGGVSLSRRSCLPVSKL 340
            ....:.|.::|| ...|..|.  .|:..|..:|.. .|.:.....|.:.||       | |...|
  Fly   571 QNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHRVGWPRKLSGG-------C-PAPIL 627

  Fly   341 TKSSIRKSLAVT------------------------------------SVRSPEKIASKPAKTST 369
            |.:...:...||                                    .:..|......|.:.:|
  Fly   628 TPAKQPRKQIVTVANETYEIIYLDDVDQGGMEEDNDFGEQMQAEEDEYPIAPPPPSPPPPPQPTT 692

  Fly   370 KSIPEKVFSCKNCSTTFRVKSLLDVHM-----------RMHDPVDNGANTLKRLNSNPVAAGVSK 423
            :...:: :.|.:|.|.|..::.:.||:           |...||.:.|        :|....|.:
  Fly   693 QGNHQR-YKCVHCGTLFATQAAVRVHISEKRCRKTVVRRRRQPVMSSA--------DPSVPTVEQ 748

  Fly   424 N---RCKFCDKNF--ALERALHIHLMQNCDKIPPSEKRKLE------------------------ 459
            |   .|..|...:  ..|...||:.:.|.||......|:|:                        
  Fly   749 NYIFLCPSCGFEYKTQFEWRRHINEVHNFDKRQYLNMRQLDKYRYQCTQCKDIVCNSKLKGLQDH 813

  Fly   460 -FTEL---------------NHEKKAQLPKIGGTSGINHPM------TMPQKPQQRISTI----- 497
             |..|               ||:     |.|.......|.:      ||..||:|.:...     
  Fly   814 HFRHLPYRLYLKCLICGTCYNHK-----PNIAAHLRARHSIFDRETPTMITKPKQVLGRYKDNSR 873

  Fly   498 --PKL--APSQGTQSMAPPSVKKIPKNVAHAGVYRT--------PTK------------------ 532
              |||  .|.....:.||||......:.|.:...|:        |.:                  
  Fly   874 ENPKLPSPPPAPALAPAPPSPPACSSSAAASASSRSLKPQPGGLPARPAGLNTLEDSISYHNAVD 938

  Fly   533 ----TVPCHICKQSFRSILEFTNHSLTVHGNNQLKKMTGRE 569
                |..|..|.|:|.|...:..|.:..|..|..:.:..|:
  Fly   939 LDFITYFCPKCNQNFDSHAFWRKHIVEQHNFNSREGLNFRQ 979

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 7/32 (22%)
C2H2 Zn finger 379..399 CDD:275368 7/30 (23%)
C2H2 Zn finger 426..444 CDD:275368 5/19 (26%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368 4/15 (27%)
C2H2 Zn finger 557..580 CDD:275368 2/22 (9%)
C2H2 Zn finger 589..609 CDD:275368 4/19 (21%)
COG5236 <939..>1096 CDD:227561 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.