DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and CG1024

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster


Alignment Length:399 Identity:73/399 - (18%)
Similarity:130/399 - (32%) Gaps:101/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 TEVSNEGVSMLVSPAGAEKEVAHVNEV-----VNEVSELIAKALK------------ISADSVKP 257
            ||:....|:.|.:|....|.:::|:|:     :|...:::.|..|            :..:....
  Fly   193 TEMEKSPVTALAAPVNEPKPISNVSELNLDRCLNAYEDIVRKEEKEVVPKYDDELDALCKEFFDD 257

  Fly   258 ATSKLKVEAGKKRQSMSSTYSGAALPRPRRSYLPTTTAETRTYSFKQRMSVVVKTTLNSPARKRS 322
            ..|..|.||.:::|...:                         ..:|....||...:::..::. 
  Fly   258 GPSAGKGEANEEQQQDDA-------------------------HLQQGNQEVVIIEIDALGKEE- 296

  Fly   323 VGGGVSLSRRSCL--PVSKLTKSSIRKSLAVTSVRSPEKIASKPAKTSTKSIPEKV-FSCKNCST 384
                |:..::...  |:|:.||   |:.::.|..|..:      .:.||..:.:.: :.|..|..
  Fly   297 ----VAQLKKEMKSDPISQPTK---RRRISTTPSRDSD------TEMSTNGLTKLISYLCPKCGK 348

  Fly   385 TFRVKSLLDVHM-RMHDPVDNGANTLKRLNSNPVA----------AGVSKNRCKFCDKNFALERA 438
            ..........|: :.||......|:.|.|.|...|          ..|.....|.|.|:......
  Fly   349 EIASMDGWRAHVFKKHDFEHIIENSFKILESGRKAMCLQCREVQPTTVRSQLQKHCFKHLPYRSY 413

  Fly   439 LHIHLMQNCDKIPPSEKRKLEFTELNHEKKAQLPKIGGTSGINHPMTMPQKPQQRISTIPKLA-P 502
            |...|   ||:...|..:.|.....||:::.|               ...|.|..|...|..| |
  Fly   414 LKCTL---CDRTKTSTSKILNHIRYNHQEELQ---------------RKNKTQLLIKPEPMWASP 460

  Fly   503 SQ-GTQSMAPPSVKKIPKNVAHAGVYRTPTKTVPCHICKQSFRSILEFTNHSLTVHGNNQLKKMT 566
            :: |..:||.           .||......:...|..|.:.|||...:..|..:...:...|.:.
  Fly   461 NKSGQAAMAD-----------DAGSEDDQGEQAVCEHCDRVFRSKWRYERHIASCRRSGAGKSVE 514

  Fly   567 GREDAQSAH 575
            |..:|...|
  Fly   515 GTVEALLNH 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 3/22 (14%)
C2H2 Zn finger 379..399 CDD:275368 3/20 (15%)
C2H2 Zn finger 426..444 CDD:275368 4/17 (24%)
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368
C2H2 Zn finger 106..123 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.