DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and CG10654

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:266 Identity:51/266 - (19%)
Similarity:87/266 - (32%) Gaps:91/266 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 CLP----VSKLT-KSSIRKSLAVTSVRSPEK--------IASKPAKTSTKSIPEKVFSCKNCSTT 385
            |||    :|::| .:|:.:.:.|....|.::        |:||......:........|:.|...
  Fly   170 CLPLAVILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGVRHTLECRICHRG 234

  Fly   386 FRVKSLLDVHMRMHDPVD-----------NGANT----LKRLNSNPVAAGVSKNRCKFCDKNFAL 435
            |...|||:.||:.|:.:.           ..||.    |:::::|..||.:. ..|..|:|.:..
  Fly   235 FYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARII-YACPSCNKVYTA 298

  Fly   436 ERALHIHLMQNCDKIPPSEKRKLEFTELNH---------EKKAQLPKIGGTSGINHPMTMPQKPQ 491
            .|:|..|:.:..::...||.     .:..|         .:||.|.:        |.|       
  Fly   299 NRSLKYHMRRTHERYHESES-----PDARHICEECGKCFARKAHLTR--------HKM------- 343

  Fly   492 QRISTIPKLAPSQGTQSMAPPSVKKIPKNVAHAGVYRTPTKTVPCHICKQSFRSILEFTNHSLTV 556
                                          .|..|   ..:...|..|.:.|.:.....:|.|..
  Fly   344 ------------------------------VHGSV---EGRRYCCECCDRRFYTKENMVDHLLRK 375

  Fly   557 HGNNQL 562
            |||..|
  Fly   376 HGNKNL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 8/21 (38%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..444 CDD:275368 6/17 (35%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 8/19 (42%)
C2H2 Zn finger 256..313 CDD:275368 12/57 (21%)
C2H2 Zn finger 289..314 CDD:275368 6/24 (25%)
zf-C2H2 323..345 CDD:278523 6/66 (9%)
C2H2 Zn finger 325..345 CDD:275368 5/64 (8%)
C2H2 Zn finger 355..376 CDD:275368 5/20 (25%)
C2H2 Zn finger 385..405 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.