DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and az2

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:259 Identity:49/259 - (18%)
Similarity:88/259 - (33%) Gaps:71/259 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 LNSPARKRSVGGGVSLSRRSCLPVSKLTKSSIRKSLAV-----TSVRSPEKIASKPAKTSTK--- 370
            |..||.|...  .:::.:.|.:.::.|..|.....|..     .|::|..:..|:..||.|.   
  Fly   286 LYDPAHKHFC--NLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIKTLTDVQC 348

  Fly   371 ---SIPEKVFSCKNCSTTFRVKSLLDVHMRMHDPVDNGANTLKRLNS-NPVAAGVSKNRCKFCDK 431
               |:.||.:                               ::|.|| .|..:...|.:|:.|:.
  Fly   349 VGLSLAEKQY-------------------------------IERCNSFMPTKSFRQKLKCEVCEH 382

  Fly   432 NFALERALHIHLMQNCDKIPPSEKRKLEFTELNHEKKAQLPKIGGTSGINHPMTMPQKPQQRIST 496
            :|:.:.||..|..:: .|:......:....|||.::|..|                |:..||:..
  Fly   383 SFSTDHALQAHQFRD-HKMGDGGWFRCTLCELNFDRKCHL----------------QQHSQRVHM 430

  Fly   497 IPKLAPSQGTQSMA---PPSVKKIPKNVAHAGVYRTPTKTVPCHICKQSFRSILEFTNHSLTVH 557
            .........::|.|   ..::.|...:..|.      .|...|..|.:.|:..::.|.|...||
  Fly   431 DKSFVCEICSRSFAFGNQLAIHKRTHDEKHV------AKPFVCEFCGKCFKQKIQMTTHVTAVH 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 0/21 (0%)
C2H2 Zn finger 379..399 CDD:275368 0/19 (0%)
C2H2 Zn finger 426..444 CDD:275368 6/17 (35%)
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916 11/56 (20%)
C2H2 Zn finger 377..398 CDD:275368 6/21 (29%)
C2H2 Zn finger 408..429 CDD:275368 8/36 (22%)
C2H2 Zn finger 436..456 CDD:275368 3/19 (16%)
C2H2 Zn finger 467..488 CDD:275368 5/20 (25%)
C2H2 Zn finger 496..516 CDD:275368
C2H2 Zn finger 524..544 CDD:275368
C2H2 Zn finger 551..572 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.