DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and wor

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster


Alignment Length:574 Identity:107/574 - (18%)
Similarity:184/574 - (32%) Gaps:190/574 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FDA-----EDTLSNAKWQSALVTQNSQFLEVHNSKVEVNTDDKDLRRTILKDLHQLTIG------ 90
            |||     ::.|:...|:        :..|:..:..:|.|     |..|.|.|.:|..|      
  Fly    68 FDAAMNQTKEQLARRIWE--------ETREIARAFPDVFT-----REEIAKSLARLGYGEFELPP 119

  Fly    91 ---------EPDQNSPLRPFDKSILNRHNALCSTPSKGNISTETQTPQIMESIDLTQIDDKENTQ 146
                     ||:|:.|||                      .|...:|.|:::    :..|:|...
  Fly   120 EEEVMEPEPEPEQHLPLR----------------------YTRDASPTIIKA----EPSDEEQFP 158

  Fly   147 PEGCGGDNSTLSSSVDVTANTVKANTLKTGDATMDNVSLQEAAKTPAPSQVYP------------ 199
            ....   |:.|..|:....:.:|...:|           :|....|:|...||            
  Fly   159 LRNY---NNNLLKSIAEYEDCMKMQNIK-----------EEIPPIPSPQLFYPPPTPLAEPEDLS 209

  Fly   200 ------LSANVVLENITE--VSNEGVSMLVSPAGAEKEVAHVNEVVNEVSELIAKALKISADSVK 256
                  ||.|:.|:|:..  :|.:.::...:|...:.|....|:.:|::.      :|.|.|...
  Fly   210 VTQRRVLSENMNLQNVARALLSMQHMAPQHAPPPIDMEEDQENQDINQLK------IKSSNDLYY 268

  Fly   257 PATSKLKVEAGKKRQSMSSTYSGAALPRPRRSYLPTTTAETRTYSFKQRMSVVVKTTLNSPARKR 321
            ......|..|         ||:|....:...:|      |:..|..               .|.:
  Fly   269 QCQQCNKCYA---------TYAGLVKHQQTHAY------ESTEYKI---------------IRSQ 303

  Fly   322 SVGGGVSLSRRS-CLPVSKLTKSSIRKSLAVTSVRSPEKIASKP-----------------AKTS 368
            ..|.|..:.:.. |...:    |::.::..|.|.:|.:|....|                 :|..
  Fly   304 PGGSGAIVDQTEFCTDQA----SALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQ 364

  Fly   369 TKSIP-------EKVFSCKNCSTTFRVKSLLDVHMRMHD-----PVDNGANTLKRLNSNPVA--A 419
            ....|       :||||||||..|:.....|.:|:|.|.     |:...|.:...|....:.  .
  Fly   365 QFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHT 429

  Fly   420 GVSKNRCKFCDKNFALERALHIHLMQNCD----KIPPSEK--RKLEFTELNHEKKAQLPKIGGTS 478
            |.....|:.|::.||....|..|:..:.|    ..|...|  .::.....:.:...|..:.||.|
  Fly   430 GEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQSGCQTEQSGGPS 494

  Fly   479 GINHPMTMPQKPQQRISTIPK------------LAPSQGTQ------SMAPPSV 514
            |....... |:.||.:....:            :..|.|.:      .|.||::
  Fly   495 GSGGGFDQ-QQLQQHLQVYEEGHNPHQLYYAGSVGSSNGEEEEGGEYQMQPPAI 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 10/21 (48%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..444 CDD:275368 6/17 (35%)
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 5/28 (18%)
C2H2 Zn finger 317..334 CDD:275368 4/20 (20%)
zf-C2H2 345..367 CDD:278523 1/21 (5%)
C2H2 Zn finger 347..367 CDD:275368 1/19 (5%)
PHA00732 379..>417 CDD:177300 14/37 (38%)
C2H2 Zn finger 382..402 CDD:275368 8/19 (42%)
zf-C2H2_8 405..482 CDD:292531 13/76 (17%)
zf-C2H2 406..428 CDD:278523 3/21 (14%)
C2H2 Zn finger 408..428 CDD:275368 3/19 (16%)
zf-H2C2_2 421..444 CDD:290200 3/22 (14%)
zf-C2H2 434..456 CDD:278523 6/21 (29%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
zf-H2C2_2 448..473 CDD:290200 5/24 (21%)
C2H2 Zn finger 464..481 CDD:275368 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.