DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and CG4496

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster


Alignment Length:411 Identity:83/411 - (20%)
Similarity:145/411 - (35%) Gaps:129/411 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 ENITEVSNEGVSMLVSPAG----AEKEVAHVNEVVNEVS---ELIAKAL-KISA-----DSVKPA 258
            :.:.|:..|...   ||.|    |.:.:||.|..:..|:   |||.:.: ::.|     ||....
  Fly   108 QEVIELDEEEAQ---SPRGLIISAARSLAHWNSSIRRVTPDIELIPRRVHRVVAEIELSDSDHDE 169

  Fly   259 TSKLKVEAGKKRQSMSSTYS-----GAALPRPRRSYLPTTTAETRTYSFKQRMSVVVKTTLNSPA 318
            .|::..:......::|...:     |:..|:.....:|:...:      :|:...|:|...:...
  Fly   170 DSEVDEDVSLPSNAVSCVLNEQRQDGSQNPQELVIIVPSDQED------EQKTDNVIKRKSSGSR 228

  Fly   319 R--KRSVGGGVSLSRR-----SCLPVSKLTKS--SIRKSLAVTSVRSPEKIASKPAKTSTKSIPE 374
            |  ||..|.    :||     .|....|..:|  ::|:.:.:.:                   .|
  Fly   229 RLVKRRPGA----NRRGRHMYECPDCGKKVQSNYNLRRHMMIHT-------------------GE 270

  Fly   375 KVFSCKNCSTTFRVKSLLDVHMR--MHDP------VDNGANTLKRLNSNPVAAGVSKNRCKFCD- 430
            :.|.|..|...||..|.|..|.|  .|||      ...||         |:..  ...||..|: 
  Fly   271 RPFPCDLCERRFREFSDLKKHRRRHSHDPQFICMICHLGA---------PLEQ--DSTRCADCES 324

  Fly   431 KNFAL--------ERALHIHLMQNCDKIPPSEKRKLEFTELNHEKKAQLPKIGGTSGINHPMTMP 487
            ||..:        |:....|    .|:: ..:..::|...|.:||:.|               :.
  Fly   325 KNLMVKPQPEELGEKTTEEH----SDEM-EGDDDEIEEAALENEKQPQ---------------VA 369

  Fly   488 QKPQQRISTIPKL-APSQGTQSMAPPSVKKIPK---------------NVAHAGVYRTPTKTVPC 536
            .:|...::.||.: :|.:...|...||...:|:               |:|...:.|| .::.||
  Fly   370 TQPSLMVTLIPPIQSPPEKVPSHTQPSRPPLPRSCSSANSSSSLSNDGNIAGKSMSRT-RRSYPC 433

  Fly   537 HICKQSFRSILEFTNHSLTVH 557
            .:|.:.|.     |.|:|..|
  Fly   434 PLCHRPFG-----TRHNLKRH 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 9/23 (39%)
C2H2 Zn finger 379..399 CDD:275368 8/21 (38%)
C2H2 Zn finger 426..444 CDD:275368 6/26 (23%)
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 4/21 (19%)
C2H2 Zn finger 247..267 CDD:275368 4/19 (21%)
zf-H2C2_2 259..282 CDD:290200 5/41 (12%)
C2H2 Zn finger 275..295 CDD:275368 8/19 (42%)
zf-C2H2 431..453 CDD:278523 8/24 (33%)
C2H2 Zn finger 433..453 CDD:275368 7/22 (32%)
zf-H2C2_2 445..468 CDD:290200 2/5 (40%)
C2H2 Zn finger 461..481 CDD:275368
C2H2 Zn finger 489..510 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.