DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and CG1529

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:392 Identity:68/392 - (17%)
Similarity:120/392 - (30%) Gaps:124/392 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VSMLVSPAGAEKEVAH-----------VNEVVNEVSELIA--KALKISADSVK--PATSKLK--- 263
            :.:|..|.|...|:.:           :.:|..|.|:.:.  :.:.|:.|.||  |....||   
  Fly    41 IDILKQPHGFPTEICNLCHNAVVYFDELRQVARESSQKLIGWQPVDIAVDRVKEEPPDEGLKENH 105

  Fly   264 ------VEAGKKRQSMSSTYSGAALPRPRRSYLPTTTAETRTYSFKQRMSVVVKTTLNSPARKRS 322
                  :|...::|:.......:.....::..|.....|.....::           ||   ::.
  Fly   106 EENEHELEEEHEKQADGQQVDLSKKQEDQKKILDDREDEEYPDEYE-----------NS---QQQ 156

  Fly   323 VGGGVSLSRRSCLPVSKLTKSSIRKSLAVTSVRSPEKIASKPAKTSTKSIPEKVFSCKNCSTTFR 387
            :..|....||:.|...:..|...:.......:||..:..|||            |.|::|..:|.
  Fly   157 LSQGTGSKRRAGLACDQCGKQVYKLPYLEAHIRSVHQGYSKP------------FLCRSCDKSFT 209

  Fly   388 VKSLLDVHMR-MHDPVDNGANTLKRLNSNPVAAGVSKNRCKFCDKNFALERALHIHLMQNCDKIP 451
            ....|..||| .|..::.....|:.|            .|:.|::.::.:.||..||.::.    
  Fly   210 RYEQLRSHMRNAHPQLEQLQQELRDL------------ICELCNRQYSTKNALGEHLKRHA---- 258

  Fly   452 PSEKRKLEFTELNHEKKAQLPKIGGTSGINHPMTMPQKPQQRISTIPKLAPSQGTQSMAPPSVKK 516
               :||....|     ...:.|:..|..:.|..|                               
  Fly   259 ---QRKEHVCE-----HCGVAKVTRTELLTHLRT------------------------------- 284

  Fly   517 IPKNVAHAGVYRTPT-KTVPCHICKQSFRSILEFTNHSLTVHGNNQ------LKKMTGREDAQSA 574
                       ..|| :...|..|.|.||.....:.|...||...:      .:|..|...:|..
  Fly   285 -----------HNPTWERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVR 338

  Fly   575 HD 576
            |:
  Fly   339 HE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 8/22 (36%)
C2H2 Zn finger 379..399 CDD:275368 7/20 (35%)
C2H2 Zn finger 426..444 CDD:275368 5/17 (29%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 7/37 (19%)
C2H2 Zn finger 171..192 CDD:275368 3/20 (15%)
zf-C2H2_2 201..>257 CDD:289522 16/67 (24%)
C2H2 Zn finger 201..222 CDD:275368 7/20 (35%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 265..285 CDD:275368 5/66 (8%)
zf-C2H2_8 268..349 CDD:292531 18/115 (16%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275368 4/18 (22%)
C2H2 Zn finger 360..380 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.