DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and CG6470

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001285409.1 Gene:CG6470 / 32840 FlyBaseID:FBgn0030933 Length:337 Species:Drosophila melanogaster


Alignment Length:335 Identity:83/335 - (24%)
Similarity:133/335 - (39%) Gaps:45/335 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 ITEVSNEGVSMLVSPAGAEKEVAHVNEVVNEVSELIAKALKISAD--SVKPATSKLKVEAGKKRQ 271
            :......|.|.:......|.:|.:....|......::::.:.||.  :.|.:|:.....||::..
  Fly    10 VKRAKRTGCSRIQPQEFVEAQVENARRAVERKLIYLSESNRASASTRAAKRSTAGAGGGAGREGS 74

  Fly   272 SMSSTYSGAALPRPRRSYLPTTTAETRTYSFKQRMSVVVKTTLNSPARKRSVGGGVSLSRRSCLP 336
            ||:....|....|.:||.|.....|.   :.::..|.:.||......|:.|....:|..|....|
  Fly    75 SMAGHAHGERRRRSKRSLLHAPAQEE---TDEEESSPLEKTNNYDNRRRSSCNLLLSPRRNGLTP 136

  Fly   337 VSKLTKSSIRKSLAVTSVRSPEKIASKP------------------------AKTSTKSIPEKVF 377
            .:...::...:..|:.:.:......:||                        :..:.:.:|.  :
  Fly   137 RNYEAEAEAAEMEAIMAAQQASNGTTKPDHDEGDGGEYQGGPFGRLQLKPLGSYATDQQLPS--Y 199

  Fly   378 SCKNCSTTFRVKSLLDVHMRMHDPVDNGANTLKRLNSNPVAAGVSKNRCKFCDKNFALERALHIH 442
            ||..|...|.::|||..|...||. |.......|..........:.:.||:||::|.|||.||||
  Fly   200 SCGVCGAKFHIRSLLGAHRHTHDD-DFKVRFRARRPRESRTTLTTVHLCKYCDRSFDLERTLHIH 263

  Fly   443 LMQNCDKIPPSEKRKLEFTELNHEKKAQLPKIGGTSGINHPMTMPQKPQQRISTIPKLAPSQGTQ 507
            |:..|.||||.::|||.||||.|||||.||..             |:.||.:......|.:|..|
  Fly   264 LLSYCKKIPPQQRRKLAFTELAHEKKAPLPNF-------------QRAQQPVHHQGNSATNQQDQ 315

  Fly   508 SMAPPSVKKI 517
            ......::||
  Fly   316 MTQQEKLQKI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 8/21 (38%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 426..444 CDD:275368 12/17 (71%)
CG6470NP_001285409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457065
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C3MS
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019426
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.