DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and CG9609

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:359 Identity:71/359 - (19%)
Similarity:129/359 - (35%) Gaps:94/359 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 KISADS-VKPATSKLKVEAGKKRQSMSSTYSGAALPR-----------PRRSYLPTTTAE----- 296
            :|::|| ::.|..:.|...| :|.|:.|.....::|:           .|..|..|...:     
  Fly     6 QIASDSDMETALEEFKQRQG-RRNSIGSAKYACSMPKCEATFKRLDQLDRHEYHHTGIKKHACSY 69

  Fly   297 ---TRTYSFKQRMSVVVKTTLNSP--ARKRSVGGGVSLSRRSCLPVSKLTKSSIRKS-------- 348
               .:|||....:...:::|...|  |.|::|...:....:..:.||.:|: .:|::        
  Fly    70 EGCDKTYSIVTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVSNMTR-HMRETHESPKVYP 133

  Fly   349 LAVTSVRSPEKIASKPAKTSTKSIPEKVFSCKNCSTTFRVKSLLDVH---MRMHD----PVDNGA 406
            .:..|.:..:|:..|..:....:: |..:||..||..|..:.....|   .::::    |:....
  Fly   134 CSQCSAKFSQKLKLKRHEIREHTL-EYPYSCSKCSRGFYQQWQCQSHEPSCKLYECPGCPLQFDK 197

  Fly   407 NTLKRLNSNPVAAGVSKNRCKFCDKNFALERALHIHLMQNCDKIPPSE-KRKLEFTELNHEKKAQ 470
            .||...:......|.::::|..||..|              ||  ||| ||.|   |:.|::.||
  Fly   198 WTLYTKHCRDSLHGKNRHKCDRCDSAF--------------DK--PSELKRHL---EVKHKEAAQ 243

  Fly   471 LPKIG-----GTSGINHPMTMPQKPQQRISTIPKLAPSQGTQSMAPPSVKKIPKNVAHAGVYRTP 530
            ..:..     ...|.....:..:..:|.:.|                         ||:| .|..
  Fly   244 TDECATSFTCNEEGCGKSYSYLRNLRQHMLT-------------------------AHSG-RRFE 282

  Fly   531 TKTVPCHICKQSFRSILEFTNHSLTVHGNNQLKK 564
            .:.:.|..|   |.|......|.|..|.:...||
  Fly   283 CQALDCGRC---FSSAQNLARHLLRDHKDGATKK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 6/24 (25%)
C2H2 Zn finger 379..399 CDD:275368 5/22 (23%)
C2H2 Zn finger 426..444 CDD:275368 4/17 (24%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 3/18 (17%)
zf-C2H2_8 67..150 CDD:292531 15/83 (18%)
C2H2 Zn finger 67..90 CDD:275368 3/22 (14%)
C2H2 Zn finger 106..126 CDD:275368 4/20 (20%)
C2H2 Zn finger 134..155 CDD:275368 3/20 (15%)
C2H2 Zn finger 188..210 CDD:275368 3/21 (14%)
C2H2 Zn finger 217..237 CDD:275368 13/38 (34%)
C2H2 Zn finger 253..276 CDD:275368 3/47 (6%)
C2H2 Zn finger 283..302 CDD:275368 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.