DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8478 and CG11398

DIOPT Version :9

Sequence 1:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:258 Identity:56/258 - (21%)
Similarity:92/258 - (35%) Gaps:63/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 GGGVSLSRRSCLPVSKLTKSSIRKSLAVTSVRSPEKIASKPAK--TSTKSIPEKVFSCKNCSTTF 386
            ||..|...|.| |...||    |:.||          |.:|..  ...:..|....:|..|...|
  Fly    45 GGSPSFVCRRC-PALFLT----REELA----------AHRPTHRYQGGQQTPASEHACDACGRVF 94

  Fly   387 RVKSLLDVHMRMHDPVDN------GANTLKRLNSNPVAAGVSKNRCKFCDKNFALERALHIHLMQ 445
            :..:.|..||..|:.|.|      .|..::|          |...|..  ||  :.|.:::|   
  Fly    95 QKHNALVDHMNAHNDVRNYPCPECPARFVQR----------SNRECHL--KN--VHRKVYLH--- 142

  Fly   446 NCDKIPPSEKRKLEFTELN------HEKKAQLPKIGGTSGINHPMTMPQKPQQRISTIPKLAPSQ 504
            :|.: |..:||..:..|.:      |:.:..|.....::..:||:...:          .||...
  Fly   143 SCPE-PGCKKRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRK----------HLASHG 196

  Fly   505 GTQSMAPPSVKKI---PKN-VAHAGVYRTPTKTVPCHICKQSFRSILEFTNHSL-TVHGNNQL 562
            ..:|...|...|:   |:| ..|..|: :..|...|.:|...:....:...|.| :.|.|:.:
  Fly   197 SAKSYGCPICGKLFGRPENRDVHLFVH-SICKAYICSVCGADYMRRNQLIRHGLASGHHNDPI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 6/21 (29%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..444 CDD:275368 5/17 (29%)
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 10/34 (29%)
C2H2 Zn finger 87..107 CDD:275368 6/19 (32%)
C2H2 Zn finger 115..136 CDD:275368 6/34 (18%)
C2H2 Zn finger 144..165 CDD:275368 5/21 (24%)
C2H2 Zn finger 175..195 CDD:275368 4/29 (14%)
C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..247 CDD:275368 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.