DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and SPO20

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_013730.1 Gene:SPO20 / 855031 SGDID:S000004619 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:253 Identity:62/253 - (24%)
Similarity:101/253 - (39%) Gaps:72/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VENAEP---------RTELQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQL 59
            :||.:|         |:|::..:.|       |:::|.|.|....|::..|.|.|..|..|..||
Yeast   160 LENVQPEEDEIVDRLRSEIRSTKLK-------SVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQL 217

  Fly    60 DRIEEGMDRINADMREAEKNLSGM----------------------EKCCGICVLPWKKVNIKDD 102
            .:||...|.:......|::.:..:                      ||...|..|..|..:::. 
Yeast   218 TKIESNCDMLKIQSNVADRKIDELAHENRSLLALKSPNPFRKKREREKRDQIYNLKLKHRHLQQ- 281

  Fly   103 GESAWKANDDGKIVASQPQRVIDERERGGMGAPPQSGYVARITNDARE-----DEMDE------- 155
             |:..:|.|..|.:|.   .:..|..|.|.|...|     ||..||::     ||.|.       
Yeast   282 -ETMKRAQDSDKNLAI---NLSSEYGRYGQGVERQ-----RILRDAQKYQFEADEEDNQMEIDLY 337

  Fly   156 -NLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIRMDGVNKRANNLLKS 212
             ||.|:.::.|:|:.||...|.|.|.||.::..|.     ||:      ::|:|.|::
Yeast   338 GNLEQIKAVSGDLKIMAHAFGREFEAQNTRMFDIE-----NNV------QQADNALQA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 17/63 (27%)
SNAP-25 93..148 CDD:395673 13/54 (24%)
SNARE_SNAP25C 150..208 CDD:277238 19/70 (27%)
SPO20NP_013730.1 SNARE_SEC9N 176..245 CDD:277239 18/75 (24%)
t_SNARE 327..392 CDD:197699 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.