DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and SNAP29

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001318503.1 Gene:SNAP29 / 830681 AraportID:AT5G07880 Length:251 Species:Arabidopsis thaliana


Alignment Length:207 Identity:54/207 - (26%)
Similarity:102/207 - (49%) Gaps:18/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINADMREAE 77
            :|||:..:...::|:.::.:..|.:.:|.:....:|||.|::||:|:.|..:....::..:...|
plant    54 VQELESYAVYNSEETTKTVQGCLKVAEEIRCDASKTLVMLNEQGDQITRTHQKTVDLDHHLSRGE 118

  Fly    78 KNLSGMEKCCGICVLPWK-KVNIKDDGESAWKANDDGKIVASQPQRVIDERERGGMGAPPQSGYV 141
            |.|.   :..|:....|| |.:....|....|.:       |..::|||.:.|..:|..|.....
plant   119 KILG---RLGGVFSRTWKPKKSRSITGPVITKGD-------SPKRKVIDLKTREKLGLNPSLKPK 173

  Fly   142 ARITNDARE-------DEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIRM 199
            ::...:|.:       .:.||.|..::::||.|:|||:|||:.:|.|..::|.:....|..|.|:
plant   174 SKTLPEAVDAYQKTQIAKQDEALTDLSALLGELKNMAVDMGTAIERQTNELDHLQDNADELNYRV 238

  Fly   200 DGVNKRANNLLK 211
            ...|:||..||:
plant   239 KQSNQRARYLLR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 14/63 (22%)
SNAP-25 93..148 CDD:395673 12/55 (22%)
SNARE_SNAP25C 150..208 CDD:277238 21/64 (33%)
SNAP29NP_001318503.1 SNARE_SNAP25N_23N_29N_SEC9N 60..122 CDD:277214 13/61 (21%)
SNARE 193..246 CDD:304603 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2314
OMA 1 1.010 - - QHG60093
OrthoDB 1 1.010 - - D1197028at2759
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm952
orthoMCL 1 0.900 - - OOG6_102919
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.