DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and Snap47

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001343381.1 Gene:Snap47 / 67826 MGIID:1915076 Length:413 Species:Mus musculus


Alignment Length:318 Identity:56/318 - (17%)
Similarity:96/318 - (30%) Gaps:139/318 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQVADESLESTR--RMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINADM---------- 73
            |..|:.....||  .::.||..|::....|...|..|.||||.:.:|::::.:|:          
Mouse   107 GTAANIPSHVTRGQELIGLMANSQKRMEDTAKDLQQQSEQLDSVLKGLEKMESDLDVADRLLTEL 171

  Fly    74 --------------REAEKNL-SGMEKCC------GICV-LPWKKVNIKDDGESAWKAN------ 110
                          ..||:|| .|:...|      |:.: :|   ..|.:..||..|..      
Mouse   172 ETPSWWPFGSKFWKMPAEENLKEGVSSTCEPFGKEGVVITVP---AIISERAESHSKLGKLTVLV 233

  Fly   111 ---------------------DD------------------------------------------ 112
                                 ||                                          
Mouse   234 SALEIYDSCSLLLHRFEKEDVDDIKVHSPYEVSIRQRFIGKPDVAYQLISAKMPEVIPILEVQFS 298

  Fly   113 -------------GKIVASQPQRVIDERERGGMGAP----PQSGYVARITNDAREDEMDENL--- 157
                         .|:.||..:|....|.:|  ..|    |..|      .:..:.::.:||   
Mouse   299 SKIELLEDALVLRNKVFASSAERHAASRPKG--CTPHRELPTGG------QEGEQLQLQKNLPLF 355

  Fly   158 -----GQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIRMDGVNKRANNLL 210
                 .::..:|..::.:|||..:|||.|:..:|.|....|...:.:|..|:|...|:
Mouse   356 SEGEAQELTQILSKMKGLALDTEAELERQDAALDGITVAVDRATLNVDKQNRRMRKLM 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 20/87 (23%)
SNAP-25 93..148 CDD:395673 16/140 (11%)
SNARE_SNAP25C 150..208 CDD:277238 16/65 (25%)
Snap47NP_001343381.1 PH-like 2..98 CDD:418428
SNARE_SNAP47N 106..170 CDD:277241 16/62 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..342 6/28 (21%)
SNARE 353..411 CDD:419871 14/57 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.