DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and Snap29

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_075837.3 Gene:Snap29 / 67474 MGIID:1914724 Length:260 Species:Mus musculus


Alignment Length:226 Identity:52/226 - (23%)
Similarity:105/226 - (46%) Gaps:25/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PRTELQELQFKSGQV---ADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRIN 70
            |...:...|:...:|   |:.:..||.|.|:||.||::.|:.:...|..|...|:..|:.:|:::
Mouse    35 PDAPIDRQQYLRQEVLRRAEATAASTSRSLSLMYESEKIGVASSEELVRQRGVLEHTEKMVDKMD 99

  Fly    71 ADMREAEKNLSGMEKCCGICVLPWKKVNI----KDDGESAWKAN------------DDGKIVASQ 119
            .|::.::|:::.::...|..:..:|...:    :.:|....:.|            .:.|..||.
Mouse   100 QDLKMSQKHINSIKSVFGGFINYFKSKPVEPPPEQNGSIVSQPNSRLKEAINTSKDQENKYQASH 164

  Fly   120 PQ-RVIDERERGGMGAPPQSG-----YVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSEL 178
            |. |.:.:.|...:...|.|.     |....|......::|.||.:::..||:|:::||.|.:|:
Mouse   165 PNLRRLQDAELDSVPKEPSSTVNTEVYPKNSTLRTYHQKIDSNLDELSVGLGHLKDIALGMQTEI 229

  Fly   179 ENQNKQVDRINAKGDANNIRMDGVNKRANNL 209
            |.|:..:||:..|.|..::.:....|:...|
Mouse   230 EEQDDILDRLTTKVDKLDVNIKSTEKKVRQL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 18/66 (27%)
SNAP-25 93..148 CDD:395673 13/76 (17%)
SNARE_SNAP25C 150..208 CDD:277238 17/57 (30%)
Snap29NP_075837.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 1/6 (17%)
SNARE_SNAP29N 47..111 CDD:277240 18/63 (29%)
SNARE_SNAP29C 201..259 CDD:277209 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.