DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and Snap23

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_038961739.1 Gene:Snap23 / 64630 RGDID:620221 Length:221 Species:Rattus norvegicus


Alignment Length:216 Identity:106/216 - (49%)
Similarity:145/216 - (67%) Gaps:18/216 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINADMREAEK 78
            :|:|.::.||.|||||||||:|.|..||::|||:|:..||:|||||:|||||||:||.|||||||
  Rat     7 EEIQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEK 71

  Fly    79 NLSGMEKCCGICVLPWKKVNIK-----------DDG---ESAWKANDD---GKIVASQPQRVIDE 126
            .|:.:.||||:||.|..:.::.           :.|   ::.|....|   ..:|:.||.|:.:.
  Rat    72 TLTELNKCCGLCVCPCNRFSVGGCFFETRTKNFESGKNYKATWGDGGDSSPSNVVSKQPSRITNG 136

  Fly   127 RERGGMGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAK 191
            :.:...|| ...||:.|||||||||||:|||.||.|:||||:|||||||:|::.||:|:.:|..|
  Rat   137 QPQQTTGA-ASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEK 200

  Fly   192 GDANNIRMDGVNKRANNLLKS 212
            .|.|..|:|..|.||..|:.|
  Rat   201 ADTNKNRIDIANTRAKKLIDS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 43/63 (68%)
SNAP-25 93..148 CDD:395673 16/71 (23%)
SNARE_SNAP25C 150..208 CDD:277238 34/57 (60%)
Snap23XP_038961739.1 SNARE_SNAP23N 9..75 CDD:277248 44/65 (68%)
SNAP-25 100..157 CDD:395673 15/57 (26%)
SNARE_SNAP23C 159..217 CDD:277237 34/57 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8287
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60093
OrthoDB 1 1.010 - - D495812at33208
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm9089
orthoMCL 1 0.900 - - OOG6_102919
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1125
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.