DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and snap29

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001243185.1 Gene:snap29 / 553460 ZFINID:ZDB-GENE-041111-226 Length:266 Species:Danio rerio


Alignment Length:239 Identity:66/239 - (27%)
Similarity:110/239 - (46%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAVENAEPRTELQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGM 66
            :::..||.|.  ::||.:..:.|..:::|:.|.|.|:.||::.|..|...|..|||.|.|.|..:
Zfish    37 SSLSPAERRQ--RQLQQEVMRTAQSAVDSSHRSLGLIYESEKVGAETAEELIRQGEALKRTERMI 99

  Fly    67 DRINADMREAEKNLSGMEKCCGICVLPWK------KVNIKDD--------------GESAWKAND 111
            |.:..|||.::::::.::...|..|..:|      |...||.              .||  |..:
Zfish   100 DNMEQDMRTSQRHINTIKSVWGGMVNYFKGKPEPPKPAQKDQPVCYEASSRLQTALAES--KQQE 162

  Fly   112 DGKIVASQPQRVIDERERGGMGA--------PPQSGYVARITNDAREDEMDENLGQVNSMLGNLR 168
            | |..||.|.  :.:.|..|.||        ..|:|:.......|...::|.||.:::..||.|:
Zfish   163 D-KYQASHPN--LRKLETSGFGASAALDNGSSDQNGFPKNKQLRAAHQQLDRNLDEMSLGLGRLK 224

  Fly   169 NMALDMGSELENQNKQVDRINAKGDANNIRMDGVNKRANNLLKS 212
            |:.|.:.:|::.|:..:|.:..|.|.    |||.....|..|||
Zfish   225 NLGLGLQTEIDEQDISLDALLNKADT----MDGKISSTNRQLKS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 20/63 (32%)
SNAP-25 93..148 CDD:395673 18/82 (22%)
SNARE_SNAP25C 150..208 CDD:277238 16/57 (28%)
snap29NP_001243185.1 SNARE_SNAP29N 51..115 CDD:277240 20/63 (32%)
SNARE_SNAP29C 206..263 CDD:277209 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.