DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and snap25

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001016501.1 Gene:snap25 / 549255 XenbaseID:XB-GENE-948769 Length:206 Species:Xenopus tropicalis


Alignment Length:208 Identity:119/208 - (57%)
Similarity:158/208 - (75%) Gaps:5/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ENAEPRTELQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRI 69
            ::|:.|.||:|:|.::.|:||||||||||||..::.||:|||||||.||:|||||:||||||::|
 Frog     3 DDADMRNELEEMQRRADQLADESLESTRRMLQYVEGSKDAGIRTLVMLDEQGEQLERIEEGMEQI 67

  Fly    70 NADMREAEKNLSGMEKCCGICVLPWKKVNIKDDGESAWKANDDGKIVASQPQRVIDERERGGMGA 134
            |.||:||||||:.:.|.||:||.|..|:...|..:.||..|.|| :|||||.||:||||:..:  
 Frog    68 NKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDG-VVASQPARVVDEREQMAI-- 129

  Fly   135 PPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIRM 199
              ..|:|.|:||||||.||||||.||:.::||||:||||||:|::.||:|:|||..|.|:|..|:
 Frog   130 --SGGFVRRVTNDARETEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKARI 192

  Fly   200 DGVNKRANNLLKS 212
            |..||.|..:|.|
 Frog   193 DEANKHATKMLGS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 45/63 (71%)
SNAP-25 93..148 CDD:395673 24/54 (44%)
SNARE_SNAP25C 150..208 CDD:277238 34/57 (60%)
snap25NP_001016501.1 SNARE_SNAP25N 10..82 CDD:277247 49/71 (69%)
SNAP-25 91..141 CDD:366328 24/54 (44%)
SNARE_SNAP25C 143..201 CDD:277238 34/57 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5835
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13311
Inparanoid 1 1.050 232 1.000 Inparanoid score I3343
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1197028at2759
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm9503
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3593
SonicParanoid 1 1.000 - - X1125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.