DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and zgc:101731

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001020729.1 Gene:zgc:101731 / 447892 ZFINID:ZDB-GENE-040912-57 Length:209 Species:Danio rerio


Alignment Length:207 Identity:116/207 - (56%)
Similarity:151/207 - (72%) Gaps:13/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTELQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINADMR 74
            |:|::|||.|:.|:.|||||.||.|..|::|||:|||||||.||:|||||||||||:|:||.||:
Zfish     8 RSEVEELQKKANQMTDESLEVTRNMKLLLEESKDAGIRTLVMLDEQGEQLDRIEEGLDQINKDMK 72

  Fly    75 EAEKNLSGMEKCCGICVLPWKKVNIKDDGES-----AWKANDDGKIVASQP-QRVIDERERGGMG 133
            ||||||:.|..|||:|:  |....:||...|     .|..|.|| :|:||| .||:||||:..| 
Zfish    73 EAEKNLTDMAMCCGLCI--WPCTKLKDFEASGAYKKVWGNNQDG-VVSSQPSSRVVDEREKMTM- 133

  Fly   134 APPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIR 198
               ..||:.|:|||||||||:|||.||.|:|||||:||||||:|::.||.|::||.:|...|..|
Zfish   134 ---SGGYIRRVTNDAREDEMEENLAQVGSILGNLRSMALDMGNEIDTQNVQIERIQSKAVVNESR 195

  Fly   199 MDGVNKRANNLL 210
            ::..|:||..|:
Zfish   196 INEANQRATKLI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 45/63 (71%)
SNAP-25 93..148 CDD:395673 24/60 (40%)
SNARE_SNAP25C 150..208 CDD:277238 33/57 (58%)
zgc:101731NP_001020729.1 SNARE_SNAP25N 10..81 CDD:277247 49/70 (70%)
SNAP-25 91..145 CDD:279208 23/58 (40%)
SNARE_SNAP23C 147..205 CDD:277237 33/57 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592306
Domainoid 1 1.000 119 1.000 Domainoid score I5745
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 231 1.000 Inparanoid score I3416
OMA 1 1.010 - - QHG60093
OrthoDB 1 1.010 - - D1197028at2759
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm6608
orthoMCL 1 0.900 - - OOG6_102919
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1125
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.