DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and snap23.1

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_005158781.1 Gene:snap23.1 / 393159 ZFINID:ZDB-GENE-040426-883 Length:237 Species:Danio rerio


Alignment Length:209 Identity:104/209 - (49%)
Similarity:147/209 - (70%) Gaps:11/209 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINADMREAE 77
            ::::..::.||.|||||||||||.:.:||:|.|::|:..||:|||||.|:::|||:||.|||:||
Zfish    29 VEDITMRANQVTDESLESTRRMLQMAEESRETGVKTMTMLDEQGEQLRRVDQGMDQINQDMRQAE 93

  Fly    78 KNLSGMEKCCGICVLPWKKV-NIKDDG--ESAWKANDD--------GKIVASQPQRVIDERERGG 131
            |||:.:.||||:||.|.::| :|:.||  :..|....|        |.:|:|||..|.:.:...|
Zfish    94 KNLTDLSKCCGLCVCPCERVTSIEHDGRYKRTWGTGSDNSSTEGKEGGVVSSQPTAVRNGQAVSG 158

  Fly   132 MGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANN 196
            ..:.....|:.|||||||||||:|||.||.|::|||:|:|||||:|::.|||.:|||..|.|.|.
Zfish   159 GSSGASGPYIKRITNDAREDEMEENLDQVGSIIGNLKNLALDMGNEIDKQNKTIDRITDKADMNK 223

  Fly   197 IRMDGVNKRANNLL 210
            .|:|..|:|||.||
Zfish   224 ARIDEANQRANKLL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 39/63 (62%)
SNAP-25 93..148 CDD:395673 19/65 (29%)
SNARE_SNAP25C 150..208 CDD:277238 34/57 (60%)
snap23.1XP_005158781.1 SNARE_SNAP25N_23N 34..98 CDD:277242 39/63 (62%)
SNAP-25 109..175 CDD:279208 19/65 (29%)
SNARE_SNAP23C 177..235 CDD:277237 34/57 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592302
Domainoid 1 1.000 84 1.000 Domainoid score I8168
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60093
OrthoDB 1 1.010 - - D495812at33208
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm6608
orthoMCL 1 0.900 - - OOG6_102919
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1125
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.720

Return to query results.
Submit another query.