DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and Snap29

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster


Alignment Length:234 Identity:58/234 - (24%)
Similarity:109/234 - (46%) Gaps:38/234 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AEPRTELQELQF--KSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRI 69
            :.|....|.|.:  |...:...:|:||.:.|.|:.|::|.|..|.|.|..|.|||::....:|.|
  Fly    59 SSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEVGKATAVELAKQREQLEKTSHQLDEI 123

  Fly    70 NADMREAEKNLSGMEKCCGICVLPWKKVNIKD-----------------DGESAWKAN---DDGK 114
            ::.:|.::::|:|::...|         .:|:                 ..:|:.:||   :.|.
  Fly   124 SSTLRFSQRHLTGLKSVFG---------GLKNYLSGNRDQPPTATGSPTGSQSSQEANSNINQGA 179

  Fly   115 IVASQPQRVIDERER------GGMGAPPQSGY-VARITNDAREDEMDENLGQVNSMLGNLRNMAL 172
            ...:.|...:...||      ..:...|.|.| ..|...:..:.::|.||.::.|.|..|:.:|.
  Fly   180 CGGASPSAPLSPAERYDNHPVSQLRGDPSSTYQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLAT 244

  Fly   173 DMGSELENQNKQVDRINAKGDANNIRMDGVNKRANNLLK 211
            |:|.|:|:||:.:|.:|.|.:..::::...||..:.|||
  Fly   245 DLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKLLK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 20/65 (31%)
SNAP-25 93..148 CDD:395673 12/81 (15%)
SNARE_SNAP25C 150..208 CDD:277238 18/57 (32%)
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 20/63 (32%)
SNARE_SNAP29C 222..280 CDD:277209 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.