DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and Snap47

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_955421.1 Gene:Snap47 / 303183 RGDID:735194 Length:419 Species:Rattus norvegicus


Alignment Length:317 Identity:61/317 - (19%)
Similarity:98/317 - (30%) Gaps:131/317 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQVADESLESTR--RMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINADMREAEKNLSGM 83
            |..|:.:...||  .::.||..|:.....|...|..||||||.:..|::::.:|:..|::.|:.:
  Rat   107 GTAANPTSPMTRGQELMGLMASSQRRMEDTAKVLHHQGEQLDSVMRGLEKMESDLDVADRLLTEL 171

  Fly    84 EKCC-------------------GICVLPWK--------------------------KVNIKDDG 103
            |...                   .:.|.|.:                          |:.:...|
  Rat   172 ETPSWWPFSAKFWKTPVEAKPRDSVSVAPCEPFGKEGVVIRVPAVVSQRTESHSKPGKLTVLVSG 236

  Fly   104 ESAWKAN------------DD----------------GK-------IVASQPQ------------ 121
            .....::            ||                ||       |.|..|:            
  Rat   237 LEIHDSSSLLLHRFEKEDVDDIKVHSPYEVSIRQRFIGKPDVAYRLISAKMPEVIPILEVQFSKK 301

  Fly   122 -------RVIDERER-----GG----------MGAPP--------QSGYVARITND---AREDEM 153
                   .|:..|.|     ||          ||...        |.|..:::..|   ..|.|.
  Rat   302 IELLEDALVLRSRGRASPAEGGCSIRHAASRLMGCTTHQELPTGGQEGQQSQLQKDWPLLSEGEA 366

  Fly   154 DENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIRMDGVNKRANNLL 210
            .|    :..:|..|:.:|||..:|||.|:..:|.|....|...:.:|..|:|...||
  Rat   367 QE----LTQILSKLKGLALDTEAELERQDAALDGITVAVDRATLTVDKHNRRMRKLL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 19/62 (31%)
SNAP-25 93..148 CDD:395673 20/160 (13%)
SNARE_SNAP25C 150..208 CDD:277238 18/57 (32%)
Snap47NP_955421.1 PH-like 12..98 CDD:302622
SNARE_SNAP47N 106..170 CDD:277241 19/62 (31%)
SNARE_SNAP47C 359..417 CDD:277207 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.