DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and Snap25

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001257504.1 Gene:Snap25 / 25012 RGDID:3728 Length:206 Species:Rattus norvegicus


Alignment Length:208 Identity:120/208 - (57%)
Similarity:160/208 - (76%) Gaps:5/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ENAEPRTELQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRI 69
            |:|:.|.||:|:|.::.|:||||||||||||.|::|||:|||||||.||:|||||||:||||:.|
  Rat     3 EDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHI 67

  Fly    70 NADMREAEKNLSGMEKCCGICVLPWKKVNIKDDGESAWKANDDGKIVASQPQRVIDERERGGMGA 134
            |.||:||||||..:.||||:.:.|..|:...|..:.||..|.|| :|||||.||:||||:..:  
  Rat    68 NQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDG-VVASQPARVVDEREQMAI-- 129

  Fly   135 PPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIRM 199
              ..|::.|:||||||:||||||.||:.::||||:||||||:|::.||:|:|||..|.|:|..|:
  Rat   130 --SGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRI 192

  Fly   200 DGVNKRANNLLKS 212
            |..|:||..:|.|
  Rat   193 DEANQRATKMLGS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 47/63 (75%)
SNAP-25 93..148 CDD:395673 23/54 (43%)
SNARE_SNAP25C 150..208 CDD:277238 34/57 (60%)
Snap25NP_001257504.1 SNARE_SNAP25N 10..82 CDD:277247 51/71 (72%)
SNAP-25 91..141 CDD:395673 23/54 (43%)
SNARE_SNAP25C 143..201 CDD:277238 34/57 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5336
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13311
Inparanoid 1 1.050 244 1.000 Inparanoid score I3210
OMA 1 1.010 - - QHG60093
OrthoDB 1 1.010 - - D1197028at2759
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm9089
orthoMCL 1 0.900 - - OOG6_102919
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1125
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.