DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and snap-29

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_498940.1 Gene:snap-29 / 176233 WormBaseID:WBGene00019305 Length:277 Species:Caenorhabditis elegans


Alignment Length:234 Identity:54/234 - (23%)
Similarity:102/234 - (43%) Gaps:51/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NAEPRTELQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRIN 70
            :.|...:..|.:.:  :...|||:||.|....::.|::.|..|...|.:|.|:|:..|:.:|.|:
 Worm    31 SGEDEADYYEREIE--KTLQESLDSTERSRRHLENSEKIGTSTAQQLLEQREKLENTEKNLDEIH 93

  Fly    71 ADMREAEKNLSGMEKCCG----------------ICVLPWKK---------VNIKDDGESAWKAN 110
            ...:..::||:.::...|                ...:|..|         .|:...|.||..:.
 Worm    94 RTTQMTQRNLNSLKSFFGGMFKNKFTKKPQEPTETPTVPQSKSASRLSETATNLSSGGGSATFSG 158

  Fly   111 DDGKIVASQPQRVIDERERGGMGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMG 175
            ..|       ||.:.|..|..         :.....:|.::::||||..:::.|.||:.:..|:|
 Worm   159 PSG-------QRTLTESSRSA---------IKGTRWEAMDNQIDENLDMMSANLRNLQRLGADLG 207

  Fly   176 SELENQNKQVDRINAKGDANNIRMDGV----NKRANNLL 210
            .|:::||:.:|||..|.:.|    ||:    :|:...:|
 Worm   208 KEVDSQNEMLDRIQYKAERN----DGIVRDQDKQMQKIL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 18/63 (29%)
SNAP-25 93..148 CDD:395673 11/63 (17%)
SNARE_SNAP25C 150..208 CDD:277238 20/61 (33%)
snap-29NP_498940.1 SNARE_SNAP29N 41..105 CDD:277240 18/65 (28%)
SNARE_SNAP29C 182..240 CDD:277209 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.