DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap24 and LOC100491227

DIOPT Version :9

Sequence 1:NP_524298.1 Gene:Snap24 / 41193 FlyBaseID:FBgn0266720 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_031747191.1 Gene:LOC100491227 / 100491227 -ID:- Length:203 Species:Xenopus tropicalis


Alignment Length:209 Identity:110/209 - (52%)
Similarity:148/209 - (70%) Gaps:7/209 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VENAEPRTELQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDR 68
            :||.......|:|:.:..:|.||||:.||||:.|::|||:|||||||.||:||||||||:||:|.
 Frog     1 MENTRKSEYEQQLKKRLDKVTDESLDVTRRMVQLVEESKDAGIRTLVMLDEQGEQLDRIDEGLDH 65

  Fly    69 INADMREAEKNLSGMEKCCGICVLPWKKVNIKDDGESAWKANDDGKIVASQPQRVIDERERGGMG 133
            ||.|||||||||:.|.||||:|  ...::.......:.|..:.|| |:::||.||.||||:..| 
 Frog    66 INQDMREAEKNLTDMGKCCGLC--SCHRLKCSATYRAVWGNSHDG-IISAQPSRVADEREQMMM- 126

  Fly   134 APPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIR 198
               ..||:.|:|||||||||::||.||.|:|||||:||||:|:|::.|||||::|..|..||..|
 Frog   127 ---SGGYIRRVTNDAREDEMEDNLAQVGSILGNLRSMALDVGNEIDIQNKQVEKIMEKVKANEDR 188

  Fly   199 MDGVNKRANNLLKS 212
            :...|.:|..:|||
 Frog   189 IKDANTKAKKILKS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap24NP_524298.1 SNARE_SNAP25N_23N 18..82 CDD:277242 44/63 (70%)
SNAP-25 93..148 CDD:395673 18/54 (33%)
SNARE_SNAP25C 150..208 CDD:277238 32/57 (56%)
LOC100491227XP_031747191.1 SNARE_SNAP25N 9..81 CDD:277247 46/71 (65%)
SNAP-25 89..138 CDD:395673 18/53 (34%)
SNARE 140..198 CDD:419871 32/57 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5835
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3343
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1197028at2759
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm9503
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.