DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8412 and PIG-Z

DIOPT Version :9

Sequence 1:NP_649939.1 Gene:CG8412 / 41191 FlyBaseID:FBgn0037743 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001286840.1 Gene:PIG-Z / 19835548 FlyBaseID:FBgn0266438 Length:696 Species:Drosophila melanogaster


Alignment Length:557 Identity:119/557 - (21%)
Similarity:189/557 - (33%) Gaps:218/557 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVTAAAHLVYTP---FTKVEESFNLQAMHDILYLRNNFTQYDHHDYPGVVPRT--FIGPLVVSII 65
            |......||:.|   :...:|.|     ..:..:..:..:.:|       .||  |...|.|..|
  Fly    23 FAAVRLLLVFVPQLGYVHPDEFF-----QSVEVMTGDHFRLEH-------TRTWEFNNSLPVRSI 75

  Fly    66 SAPFVLLFETLSINKFWAQYVVRLVLAGAISVAWNSLRQAVTKIYGVEVRLWFTAITITQFHFMF 130
            ..||.||....|..:|.|:.:          .||..|....|..|.|..||.:|.|:.:..:.:|
  Fly    76 VLPFALLRIPWSFYEFVAECL----------KAWWQLELLGTYAYVVFPRLIYTLISFSNDYCLF 130

  Fly   131 YMTRPLPNIFALPIVLFAIAYWLRDQHKPFIICSGIS--ILVFRS-------ELALFLGILLVVS 186
            .:.|           |:.:.:.:|      ::..|.|  :|||.:       |:|:...:|.:||
  Fly   131 RICR-----------LYGLRFEIR------LLAMGSSWILLVFGTRTFSNSLEMAMCSWLLCLVS 178

  Fly   187 --LLR----------------------RKVSIDGLLKVALP---------------AGV------ 206
              :||                      .:|.| ..||.:||               |||      
  Fly   179 ECMLRTNTVVYKKEFLEEKYDKAESISERVRI-WKLKNSLPAHNLQHLMAMSTICVAGVFNRPTF 242

  Fly   207 -----------------------------------CILAATVL---VDSFFWRRLLWPEGEVLWY 233
                                               |.|.|.||   .||.:::.|...|..::..
  Fly   243 LLFGAPMVFFWLLRGMGTRSITFRDFNLRIALFCLCALPALVLFIFCDSLYYQHLTLGELHMMHL 307

  Fly   234 NTVLNKSSNWGTSPFLWYFYSA-LPRAMGAS--------------------LVLVPIGVALE--- 274
            :.     .|:..:|  |.|..| |..|..||                    |.|..:|...:   
  Fly   308 SI-----DNFVFTP--WNFIKANLDSAQTASHGVHPCYVHLMVNMPMLFNVLALASLGAFAQLLL 365

  Fly   275 ----------PRIRPLV--LSALLFVLLY--SILPHKELRFIIYV-FPVLNIAAACACQRIWMNS 324
                      ||.:.:|  :|..:||.|:  |::.|:|.||::.| ||::.:.|.   :.|...|
  Fly   366 RFFRAEYQVLPRFQSIVSLMSGAIFVPLFFLSLINHQEPRFLLPVTFPLILLHAP---KLITGFS 427

  Fly   325 AKSTW---HSFLAL---------ACGAHLL-----LNVFITLFLLVISGTN-YPGGA-------- 363
            ||..:   |..|.|         |.|.:||     .||.:|||...|.... ||..|        
  Fly   428 AKYPFQKDHPLLRLFYDKLLSSKASGPYLLKIWYVSNVALTLFFGFIHQAGVYPLAADISHVIAT 492

  Fly   364 --ALSRLHRLEAGTSNVSVHISNLAAQSGVSRFMEIN 398
              |.:.:|.:.:...::.:|:.|:.:    ||.:..|
  Fly   493 KPAATHVHLITSHIYSLPLHLINIPS----SRVLHFN 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8412NP_649939.1 PMT_2 3..351 CDD:304453 107/497 (22%)
PIG-ZNP_001286840.1 Glyco_transf_22 18..541 CDD:281842 119/557 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22760
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.