DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12948 and si:ch211-14a17.11

DIOPT Version :10

Sequence 1:NP_649936.1 Gene:CG12948 / 41187 FlyBaseID:FBgn0037739 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001007178.3 Gene:si:ch211-14a17.11 / 368892 ZFINID:ZDB-GENE-030616-582 Length:192 Species:Danio rerio


Alignment Length:91 Identity:26/91 - (28%)
Similarity:46/91 - (50%) Gaps:14/91 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EFRYIIQWFNEWSELQRDDFVYVFVEYLARGSSSGASDGQVNGLVNSLANAAVQDKPMSLFQCRI 75
            |.|.::.||..|:..|:..|:...:        |.|..|:|:.|::.|....|.|:|.::|:|::
Zfish    92 EQRCVLSWFLGWNVAQKQRFLEDLI--------SKAVPGKVSSLLDQLNTLQVNDRPPNIFECQL 148

  Fly    76 KLFREWSPKWPIE-----FKCKLQEK 96
            :|:.:|...|..|     ..| |:||
Zfish   149 RLWTQWFDSWSEEERNAFLNC-LEEK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12948NP_649936.1 DUF4508 9..112 CDD:464413 26/91 (29%)
si:ch211-14a17.11NP_001007178.3 DUF4508 90..185 CDD:464413 26/91 (29%)

Return to query results.
Submit another query.