DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pnn and AT1G15200

DIOPT Version :9

Sequence 1:NP_001097727.1 Gene:Pnn / 41185 FlyBaseID:FBgn0037737 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001185000.1 Gene:AT1G15200 / 838086 AraportID:AT1G15200 Length:470 Species:Arabidopsis thaliana


Alignment Length:389 Identity:85/389 - (21%)
Similarity:146/389 - (37%) Gaps:130/389 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VNDSGL-STVDDLEQKLNSAKQSLVILNENIRRIAGRVPKESLQRSEKFKYTQDGKKNEHNGDRP 65
            :.|:.| .|.::|..:::...:....:.|.:|...|      |:|.   .::....:|:  |.|.
plant     1 MGDTALEKTAEELRHEIDELHRQQREITERLRDPRG------LRRG---GFSNVAPRNQ--GRRG 54

  Fly    66 FPRNATPGGVFKD---KRRMY--------ESKNPISRFPIEENEGRPPRINSRVIREMPTKKEIV 119
            |||.|....|..:   |||:.        |..:....||::.| |...::......:...||:..
plant    55 FPRPAERNDVEDEPPAKRRLSSAVVKVDGEDVSKDGEFPVDGN-GTQVKVGENGTSDQSDKKQSG 118

  Fly   120 EAQGT----DSESRA----------------------------RNRRMFGSLLGTLQKFCQEESR 152
            ..:|:    |:|.|.                            |||||.|:|||||:||.:|:.:
plant   119 LHRGSWSQRDAEQRRTNKRYEAFALPEPAPRVLPKNEDPKLVNRNRRMLGNLLGTLEKFRKEDKQ 183

  Fly   153 -------------LKSKEDKKAEIDRKVEKQELQERAMLRKQR-------------------ETL 185
                         |:..|:|..|   :.|:..||||..|.::|                   |.|
plant   184 RSGTDAYARRTAALQRAEEKARE---ESERLRLQERENLTEKRRRDLTLRARVAAKAEQKKLELL 245

  Fly   186 FLDRKKKQ----------------FEIRRLEY---KMARMKDFKVWEATMLNA--KNNI---RTK 226
            ||...:.|                |.::.:.|   |...:.:|...:.:..:.  |.|:   |||
plant   246 FLQWSEHQKKLSNFISDEIANCYVFHLQVIFYFGPKSVHIDNFIEAKISFHSRAYKGNVWCYRTK 310

  Fly   227 TKPHLFFRPKVHSPRTEKLLSKSKSEAD-----VFIEF---RREELEVELKNLENMNFGKMEDD 282
            .:|.:::.|       .|.|.:..||.:     .|:|:   ||:|:....|.:|....|.:|.:
plant   311 AEPRIYYAP-------VKPLEEDTSEVEQQKERTFLEWKAARRQEVSEYQKEIEEQCLGNVEKE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PnnNP_001097727.1 Pinin_SDK_memA 126..250 CDD:282541 45/207 (22%)
AT1G15200NP_001185000.1 Pinin_SDK_memA 157..326 CDD:368061 43/178 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3756
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005515
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12707
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.