DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pnn and Pnn

DIOPT Version :9

Sequence 1:NP_001097727.1 Gene:Pnn / 41185 FlyBaseID:FBgn0037737 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001102493.1 Gene:Pnn / 368070 RGDID:1597086 Length:729 Species:Rattus norvegicus


Alignment Length:331 Identity:95/331 - (28%)
Similarity:165/331 - (49%) Gaps:57/331 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LEQKLNSAKQSLVILNENIRRIAGRVPKE---------------------SLQRSEKFKYTQDGK 56
            |:::|..||:||..::||||::.||.|.:                     ||.....|       
  Rat     8 LQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGF------- 65

  Fly    57 KNEHNGDRPFPRNATPGGVFK---DKRRMYESK---NPISRFPIEENEGRPPRINSRVI--REMP 113
             ::..|..|..:....|.|.:   ::|...||:   :|      |:::.:.|.:.|.|:  .:..
  Rat    66 -SDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDP------EDDDVKKPALQSSVVATSKER 123

  Fly   114 TKKEIVEAQGTDSESRARNRRMFGSLLGTLQKFCQEESRLKSKEDKKAEIDRKVEKQELQERAML 178
            |::::::.|..|.:.:.||||:||.|:||||||.||.:....::.::.||::|:|.|..:||..:
  Rat   124 TRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQAEEERKQV 188

  Fly   179 RKQRETLFLDRKKKQFEIRRLEYKMARMKDFKVWEATMLNAK--NNIRTKTKPHLFFRPKVHSPR 241
            ..:|..||.:|:.||.|:|.||.|:...:..:.|...  |||  ..||||||||||:.|....|.
  Rat   189 ENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEH--NAKIIKYIRTKTKPHLFYIPGRMCPA 251

  Fly   242 TEKLLSKSKSEADVFIEFRREELEVELKNLE----NMNFGKMEDDTAIDESFYEEPDD------E 296
            |:||:.:|:.:.:...|.||.|...::..:|    ..:..:.|.....:|....|.::      |
  Rat   252 TQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQRE 316

  Fly   297 EQLDKS 302
            |:|:::
  Rat   317 EELEET 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PnnNP_001097727.1 Pinin_SDK_memA 126..250 CDD:282541 52/125 (42%)
PnnNP_001102493.1 Pinin_SDK_N 5..132 CDD:282542 35/152 (23%)
Pinin_SDK_memA 136..261 CDD:282541 50/126 (40%)
FAM75 <491..>537 CDD:291323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342125
Domainoid 1 1.000 96 1.000 Domainoid score I7197
eggNOG 1 0.900 - - E1_KOG3756
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005515
OrthoInspector 1 1.000 - - oto95781
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12707
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5120
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.