DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pnn and pnn1

DIOPT Version :9

Sequence 1:NP_001097727.1 Gene:Pnn / 41185 FlyBaseID:FBgn0037737 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_594893.1 Gene:pnn1 / 2542087 PomBaseID:SPAC26F1.02 Length:197 Species:Schizosaccharomyces pombe


Alignment Length:177 Identity:60/177 - (33%)
Similarity:90/177 - (50%) Gaps:26/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NPISRFPIEENEGRPPRINSRVIREMPTKKEIVEAQGTDSESRARNRRMFGSLLGTLQKFCQEES 151
            |..|...|::.||.....:.|.::|..|.:..||        :.|.|||||:|||||.||.||..
pombe    36 NEDSHMEIDQPEGSMEEDDHRQVKEKNTSENSVE--------QKRGRRMFGALLGTLGKFQQESE 92

  Fly   152 RLKSKEDKKAEIDRKVEKQELQERAMLRKQRETLFLDRKKKQFEIRRLEYKMARMKDFKVWEATM 216
            |    |.|.|   |||::.||:|:...|:::|...|::::| .|...||.::...:...:.|..:
pombe    93 R----EQKSA---RKVKRAELEEKLAKRREQELQELEKQEK-IEAEILESRLQEQRKVALDELEL 149

  Fly   217 --------LNAKNN--IRTKTKPHLFFRPKVHSPRTEKLLSKSKSEA 253
                    |:.|.:  :||||:|.||:||....|.....|.:.||||
pombe   150 DRNDLKKVLDNKKSYYLRTKTQPSLFYRPYYLLPSQRTQLEQMKSEA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PnnNP_001097727.1 Pinin_SDK_memA 126..250 CDD:282541 46/133 (35%)
pnn1NP_594893.1 Pinin_SDK_memA 69..193 CDD:282541 47/139 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I2977
eggNOG 1 0.900 - - E1_KOG3756
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1895
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005515
OrthoInspector 1 1.000 - - oto100589
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1769
SonicParanoid 1 1.000 - - X5120
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.