DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VII and side-II

DIOPT Version :10

Sequence 1:NP_649933.1 Gene:side-VII / 41184 FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001400995.1 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1067 Species:Drosophila melanogaster


Alignment Length:200 Identity:42/200 - (21%)
Similarity:74/200 - (37%) Gaps:58/200 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 PKELVVH-EQGKPMSKEDYENMTKNMEPNQSNEPPM-AGASFGGN----WNVGEVFREFDDLKSI 459
            ||.|||: ::|:|.:.:|.|.|  ..:|::..|..: ||.:.|..    :..||.:.|..:::..
  Fly   120 PKYLVVNADEGEPGTCKDREIM--RHDPHKLIEGCLIAGRAMGARA
AYIYIRGEFYNEASNMQLA 182

  Fly   460 KEKEKSEKEKFKSLKASGNIKEEFTVNTHIGTVLMYIPHCDYMSSDYAQQHGGYANVLNYLKKES 524
            ..:........|:...||   .:|.|..|.|.                   |.      |:..|.
  Fly   183 IAEAYQAGLIGKNACGSG---YDFDVFMHRGA-------------------GA------YICGEE 219

  Fly   525 ESFFKSIQGYSFMSKHGLANIRQQSDSFYPKDHLRIVGGSLGITSSCKRVGNVDSF-----LCRV 584
            .:..:|::|     |.|...::..    :|.|        :|:......|.||::.     :||.
  Fly   220 TALIESLEG-----KQGKPRLKPP----FPAD--------VGVFGCPTTVSNVETVAVAPTICRR 267

  Fly   585 VATHF 589
            ..|.|
  Fly   268 GGTWF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIINP_649933.1 V-set 32..134 CDD:462230
Ig_3 160..223 CDD:464046
Ig 256..328 CDD:472250
Ig strand B 262..266 CDD:409353
Ig strand C 276..280 CDD:409353
Ig strand E 302..306 CDD:409353
Ig strand F 316..321 CDD:409353
Ig 351..426 CDD:472250 10/25 (40%)
Ig strand B 364..368 CDD:409353
Ig strand C 375..382 CDD:409353
Ig strand E 401..405 CDD:409353 2/3 (67%)
Ig strand F 415..420 CDD:409353 1/4 (25%)
Ig_3 <456..519 CDD:464046 8/62 (13%)
FN3 538..620 CDD:238020 11/56 (20%)
side-IINP_001400995.1 V-set 55..163 CDD:462230 15/44 (34%)
Ig_3 190..254 CDD:464046 18/108 (17%)
Ig <292..366 CDD:472250
Ig strand B 292..295 CDD:409418
Ig strand C 305..309 CDD:409418
Ig strand E 329..333 CDD:409418
Ig strand F 343..348 CDD:409418
Ig strand G 359..362 CDD:409418
Ig 382..457 CDD:472250
Ig strand B 391..395 CDD:409405
Ig strand C 405..409 CDD:409405
Ig strand E 428..432 CDD:409405
Ig strand F 442..447 CDD:409405
Ig 486..554 CDD:409353
Ig strand B 486..490 CDD:409353
Ig strand C 500..504 CDD:409353
Ig strand E 526..530 CDD:409353
Ig strand F 540..545 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.