DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VII and CG31773

DIOPT Version :9

Sequence 1:NP_001262432.1 Gene:side-VII / 41184 FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster


Alignment Length:285 Identity:51/285 - (17%)
Similarity:99/285 - (34%) Gaps:89/285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 PCTASSRRRQKELSNENIS-------------RDESPGPSDKSSGSKEVDDCDEKNPDVVPESIE 727
            |.|.....:.:|.|.|:::             .:.:.|.:...|..||.|       .|:.:::|
  Fly   257 PSTPQPAEKPEEKSPEHLAYLDAIKQLNSYQVLEPTSGRATTKSSRKEQD-------PVIEQTLE 314

  Fly   728 PDEQAESIRK-RQQISTIDTNRSPNRGIFVNEQQHLTAAEI-SLRASHGIGYCTLRSGMHAQAQS 790
            ..|::...:| .:.|..|....|..||        .|.|.: |:...||:               
  Fly   315 CLEKSGLTKKDLKAIPVIQVAGSKGRG--------STCAIVESILRCHGV--------------- 356

  Fly   791 SVGEISINVTPHVYSNS---------ISQCTLPRQSSQNVWNNYNCNITGARPTSTFHQL----- 841
            ..|.:|   :||::..|         :|..    |.::..| ..|.::...:||.:::::     
  Fly   357 KTGVLS---SPHLFLTSERIRIDGEPLSDV----QFTELFW-KINTDLANMQPTPSYNKIMTVMA 413

  Fly   842 --TFPQGRVNVGGHNPAQPLHGHAPSPSQASNSSMASSTNTLPQPHPHGRTIAMHHMNQAQCGRV 904
              .|.|..|.|              :..:..|:..:.:||..    .|.:||.:..:...|... 
  Fly   414 FHAFHQAGVEV--------------AILEVGNAGASDATNIA----SHAQTIGITTLGWEQSSN- 459

  Fly   905 CIGIASDGIHSAEQNVSDDEVTVQT 929
             :|.:...|..|:.::...|..:.|
  Fly   460 -LGNSLRDIAWAKASIMKPEANIYT 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653
V-set 32..134 CDD:284989
IGc2 160..>214 CDD:197706
Ig 262..328 CDD:299845
IG_like 264..323 CDD:214653
IGc2 360..425 CDD:197706
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517 14/78 (18%)
CG31773NP_722953.1 folC 309..745 CDD:273659 40/226 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.