DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VII and CG30350

DIOPT Version :9

Sequence 1:NP_001262432.1 Gene:side-VII / 41184 FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:256 Identity:54/256 - (21%)
Similarity:83/256 - (32%) Gaps:86/256 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 QIDMNFAPLNIRLL----------GAHQPLSAGRRYDLLCQSAGSRPPAVITWWQ-------NGI 284
            |..|.....||:||          ||..|.    |||.: .:..|.|.|::|..:       .|.
  Fly    94 QTFMKRTKANIQLLVEISRTMRTHGAINPF----RYDTV-HAVSSIPMALLTLEKLERDNRDFGR 153

  Fly   285 R-LEKTTETTSS-------DGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLE--------- 332
            | ||..:|..|.       :|..:|....:.|......||   :|:|..:|....|         
  Fly   154 RILEVNSEVDSGLSDKRMREGRSSTPVAPLELPPQAMAKY---EAFNIPLPKSDAELRRLFRPRI 215

  Fly   333 --DGWKLDIQYVPEAYVRLGTSLDPSTLREGTDVYFDCLVMAH---------PNVFRIEWRHNE- 385
              |.:..|.:.:....|:|.|...|..:.:   :...|:...|         ||:    |...: 
  Fly   216 YFDLYLKDARPLGRFVVQLYTEAAPLVVLQ---LIKSCMCNQHSKFMVKRLFPNL----WLETDL 273

  Fly   386 ---------QPLSHNISL------GVIISNHSLVLQGVTR----------ATAGNYSCVGF 421
                     |||.::..:      ..::|.....:.|.|.          .|..|.|.|||
  Fly   274 MLSSDSLLHQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVVNGSRVGF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653
V-set 32..134 CDD:284989
IGc2 160..>214 CDD:197706
Ig 262..328 CDD:299845 19/80 (24%)
IG_like 264..323 CDD:214653 16/73 (22%)
IGc2 360..425 CDD:197706 17/97 (18%)
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 17/65 (26%)
cyclophilin 212..369 CDD:294131 23/130 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.