DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VII and Skint3

DIOPT Version :9

Sequence 1:NP_001262432.1 Gene:side-VII / 41184 FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001095944.1 Gene:Skint3 / 195564 MGIID:3045331 Length:458 Species:Mus musculus


Alignment Length:209 Identity:44/209 - (21%)
Similarity:81/209 - (38%) Gaps:60/209 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLLFMLALQLIESSIGSKDVPIHQIESIVGENIYLPCNVTTYDGDEPVLVLWYRDDKGTPIYSI 67
            |.:|.||.|...:.:|...:.|   :.:.:|..:.|.|.::.....:.:.:.|:|:....|:|. 
Mouse    15 LCVLQMLVLSSEQFTITGLERP---VLAPLGGILELSCQLSPPQNAQQMEIRWFRNRYTEPVYL- 75

  Fly    68 DIRAG-------VSKAPKRWSDDSVFGDRAYFI-FDKEPGKLSIQ--NTQASDSGTYRC------ 116
             .|.|       :||          :.:|...: .|...||::::  .....|.|:|.|      
Mouse    76 -YRNGKDLHGETISK----------YVERTELLKHDIGKGKVTLRVFKVTVDDDGSYHCVFKDGI 129

  Fly   117 ----RVDFLKAQTINSRIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPTP 177
                .:..:|....:|.|:: ::.||         |::.            |.|:|...|.:|.|
Mouse   130 FYEEHITEVKVTATSSDIKI-IMHPP---------NIKG------------VMLECHSRGWFPQP 172

  Fly   178 TISWYRD--GIEIP 189
            .:.| ||  |..||
Mouse   173 HMEW-RDSNGQVIP 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 22/121 (18%)
V-set 32..134 CDD:284989 22/121 (18%)
IGc2 160..>214 CDD:197706 12/32 (38%)
Ig 262..328 CDD:299845
IG_like 264..323 CDD:214653
IGc2 360..425 CDD:197706
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
Skint3NP_001095944.1 IG_like 35..140 CDD:214653 20/119 (17%)
Ig_MOG_like 42..141 CDD:143190 20/110 (18%)
Ig 159..221 CDD:299845 12/28 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12214
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.