Sequence 1: | NP_001262432.1 | Gene: | side-VII / 41184 | FlyBaseID: | FBgn0037736 | Length: | 939 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001095944.1 | Gene: | Skint3 / 195564 | MGIID: | 3045331 | Length: | 458 | Species: | Mus musculus |
Alignment Length: | 209 | Identity: | 44/209 - (21%) |
---|---|---|---|
Similarity: | 81/209 - (38%) | Gaps: | 60/209 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LLLLFMLALQLIESSIGSKDVPIHQIESIVGENIYLPCNVTTYDGDEPVLVLWYRDDKGTPIYSI 67
Fly 68 DIRAG-------VSKAPKRWSDDSVFGDRAYFI-FDKEPGKLSIQ--NTQASDSGTYRC------ 116
Fly 117 ----RVDFLKAQTINSRIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPTP 177
Fly 178 TISWYRD--GIEIP 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
side-VII | NP_001262432.1 | IG_like | 32..134 | CDD:214653 | 22/121 (18%) |
V-set | 32..134 | CDD:284989 | 22/121 (18%) | ||
IGc2 | 160..>214 | CDD:197706 | 12/32 (38%) | ||
Ig | 262..328 | CDD:299845 | |||
IG_like | 264..323 | CDD:214653 | |||
IGc2 | 360..425 | CDD:197706 | |||
Ig_3 | 456..519 | CDD:290638 | |||
FN3 | 538..620 | CDD:238020 | |||
FAM176 | 643..741 | CDD:291517 | |||
Skint3 | NP_001095944.1 | IG_like | 35..140 | CDD:214653 | 20/119 (17%) |
Ig_MOG_like | 42..141 | CDD:143190 | 20/110 (18%) | ||
Ig | 159..221 | CDD:299845 | 12/28 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 44 | 1.000 | Domainoid score | I12214 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |