DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VII and FCRL1

DIOPT Version :9

Sequence 1:NP_001262432.1 Gene:side-VII / 41184 FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_443170.1 Gene:FCRL1 / 115350 HGNCID:18509 Length:429 Species:Homo sapiens


Alignment Length:544 Identity:116/544 - (21%)
Similarity:188/544 - (34%) Gaps:161/544 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLFMLALQLIESS----IGSKDVPIHQIESIVGENIYLPCNVT-TYDGDEPVLVLWYRDDKGTPI 64
            ||.::...|.|.:    |.|   |.|..|   |..:.|.|.:. ....|......::||.:.   
Human     5 LLLLICAPLCEPAELFLIAS---PSHPTE---GSPVTLTCKMPFLQSSDAQFQFCFFRDTRA--- 60

  Fly    65 YSIDIRAGVSKAPKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRVDFLKAQTINS- 128
                :..|.|.:|                      ||.|......|:|:|.|....:.::.:.| 
Human    61 ----LGPGWSSSP----------------------KLQIAAMWKEDTGSYWCEAQTMASKVLRSR 99

  Fly   129 RIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPTPTISWYRD--GIEIPCE 191
            |.::||    .:|.:.|.| :|.....|...|||.:.|.|.|..|....|..||:.  |:.:..:
Human   100 RSQINV----HRVPVADVS-LETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSK 159

  Fly   192 LSHLAGGKIIECEITLPSLGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLGAHQPL 256
            ..     :.:..|..:||: ||....:..|.| .:...|....:|.|.:.. |::..:|....|.
Human   160 TQ-----RSLTAEYEIPSV-RESDAEQYYCVA-ENGYGPSPSGLVSITVRI-PVSRPILMLRAPR 216

  Fly   257 SAGRRYDLL---CQSAGSRPPAVITWWQNGIRLEKTTETTSSDGNQTTSTLSISLSKSDAGKYLS 318
            :.....|:|   |::....||.:..::...|.|  .:.:..|.|.   ::.::||::..:|.| |
Human   217 AQAAVEDVLELHCEALRGSPPILYWFYHEDITL--GSRSAPSGGG---ASFNLSLTEEHSGNY-S 275

  Fly   319 CKAYNHAVPSEPLEDGWKLDIQYVPEAYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEWRH 383
            |:|.|                        .||..                             |.
Human   276 CEANN------------------------GLGAQ-----------------------------RS 287

  Fly   384 NEQPLSHNISLGVIISNH--SLVLQGVTR----ATAGNYSCVGFNAEGEGISA-----------P 431
            ....|:..:..|. .|||  |.|::|:..    ||.....|.|...:....||           |
Human   288 EAVTLNFTVPTGA-RSNHLTSGVIEGLLSTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPLP 351

  Fly   432 FALNILYAPTCAQNQKKVYGIAKQEDAKVMCTVDANPREVEFSWTFNNSAESIDVATNHIIRSGT 496
            .....|.:||..|.| .:|     |:..|:     :..|| :|..:.|..|...||...:   ||
Human   352 QEFTYLNSPTPGQLQ-PIY-----ENVNVV-----SGDEV-YSLAYYNQPEQESVAAETL---GT 401

  Fly   497 -----TSIVTYT-----PITELDY 510
                 .|:..|:     .||::||
Human   402 HMEDKVSLDIYSRLRKANITDVDY 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 18/103 (17%)
V-set 32..134 CDD:284989 18/103 (17%)
IGc2 160..>214 CDD:197706 15/55 (27%)
Ig 262..328 CDD:299845 17/68 (25%)
IG_like 264..323 CDD:214653 15/61 (25%)
IGc2 360..425 CDD:197706 13/70 (19%)
Ig_3 456..519 CDD:290638 17/65 (26%)
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
FCRL1NP_443170.1 Ig_2 19..90 CDD:316418 21/105 (20%)
IG_like 119..201 CDD:214653 22/88 (25%)
Ig_3 207..280 CDD:316449 18/78 (23%)
ITIM motif 1 354..359 1/4 (25%)
ITIM motif 2 367..372 2/9 (22%)
ITIM motif 3 379..384 3/5 (60%)
ITIM motif 4 410..415 1/4 (25%)
ITIM motif 5 423..428 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.