DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VII and BTN3A1

DIOPT Version :9

Sequence 1:NP_001262432.1 Gene:side-VII / 41184 FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_008979.3 Gene:BTN3A1 / 11119 HGNCID:1138 Length:513 Species:Homo sapiens


Alignment Length:422 Identity:89/422 - (21%)
Similarity:138/422 - (32%) Gaps:150/422 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLLFMLALQLIE---------SSIGSKDVPIHQIESIVGENIYLPCNVTTYDGDEPVLVLW--- 55
            |||.|.:.|.|::         |.:|    |...|.::|||:..|||::......|.:.:.|   
Human    10 LLLNFRVCLLLLQLLMPHSAQFSVLG----PSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS 70

  Fly    56 --------YRDDKGTPIYSIDIRAGVSKAPKRWSD----DSVFGDRAYFIFDKEPGKLSIQNTQA 108
                    |.|.|     .::.|   ..||.|...    |.:...:|         .|.|.|..|
Human    71 SLRQVVNVYADGK-----EVEDR---QSAPYRGRTSILRDGITAGKA---------ALRIHNVTA 118

  Fly   109 SDSGTYRCRV---DF-------LKAQTINSRIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDI 163
            ||||.|.|..   ||       ||...:.|.:.::|..                     |.:|.|
Human   119 SDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKG---------------------YKDGGI 162

  Fly   164 VSLKCQVIGGYPTPTISW---------------YRDGIEIPCELSHL----AGGKIIECEITLPS 209
             .|:|:..|.||.|.|.|               ..||:.:....:.:    :.|:.:.|.|....
Human   163 -HLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSL 226

  Fly   210 LGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSAGSRPP 274
            ||.|    :....:::.|.....:..:.......|:.:.|||       |..|.|          
Human   227 LGLE----KTASISIADPFFRSAQRWIAALAGTLPVLLLLLG-------GAGYFL---------- 270

  Fly   275 AVITWWQNGIRLEKTTETTSSDGNQTTSTLSISLSKSDAG--------------KYLSCKAYNHA 325
                 ||.  :.||.|:.......|....::.|..|.:..              :|.| :...|:
Human   271 -----WQQ--QEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYAS-RGERHS 327

  Fly   326 VPSEPLEDGWKLDIQYVPEAYVRLGTSLDPST 357
            ..:|     ||..: :.|...:     |||.|
Human   328 AYNE-----WKKAL-FKPADVI-----LDPKT 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 32/126 (25%)
V-set 32..134 CDD:284989 32/126 (25%)
IGc2 160..>214 CDD:197706 17/72 (24%)
Ig 262..328 CDD:299845 13/79 (16%)
IG_like 264..323 CDD:214653 11/72 (15%)
IGc2 360..425 CDD:197706
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
BTN3A1NP_008979.3 IG_like 37..143 CDD:214653 31/122 (25%)
Ig_MOG_like 45..144 CDD:143190 30/115 (26%)
SPRY_PRY_BTN3 337..512 CDD:293992 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.