DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub85E and TUBA4B

DIOPT Version :9

Sequence 1:NP_524297.1 Gene:alphaTub85E / 41183 FlyBaseID:FBgn0003886 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001342150.1 Gene:TUBA4B / 80086 HGNCID:18637 Length:241 Species:Homo sapiens


Alignment Length:223 Identity:167/223 - (74%)
Similarity:182/223 - (81%) Gaps:23/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGT 145
            |||||:||||||||||||||||||.||||||||.:|::||||||||||||||||||||||.|.||
Human    20 GTYRQIFHPEQLITGKEDAANNYAWGHYTIGKEFIDLLLDRIRKLADQCTGLQGFLVFHSLGRGT 84

  Fly   146 GSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY 210
            ||..||.|||.|||:|||||||.||||||||||||:|:|||||||||||||||||||||||:|||
Human    85 GSDVTSFLMEWLSVNYGKKSKLGFSIYPAPQVSTAMVQPYNSILTTHTTLEHSDCAFMVDNKAIY 149

  Fly   211 DICRRNLDIERPTYMNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLV-------PYPRIHFP 268
            |||..|||||||||.||||||.||||||||||||||||||||||||||||       |:|.:|  
Human   150 DICHCNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVSYLTSTSPWPPMH-- 212

  Fly   269 LATYAPVISVEKAYHEQLTVAEITNACF 296
                  ..|::|.|        .|::|:
Human   213 ------QSSLQKRY--------TTSSCW 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub85ENP_524297.1 PTZ00335 1..448 CDD:185562 167/223 (75%)
TUBA4BNP_001342150.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 167/223 (75%)
Tubulin 20..>207 CDD:330767 159/186 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.