DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub85E and TUBAL3

DIOPT Version :9

Sequence 1:NP_524297.1 Gene:alphaTub85E / 41183 FlyBaseID:FBgn0003886 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_079079.1 Gene:TUBAL3 / 79861 HGNCID:23534 Length:446 Species:Homo sapiens


Alignment Length:446 Identity:324/446 - (72%)
Similarity:387/446 - (86%) Gaps:15/446 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRECISVHIGQAGVQIGNACWELYCLEHGIQPDG-----------HMPSDKTVGGGDDSFSTFFS 54
            ||||:|:||||||:|||:||||||||||||||:|           :...:.|    :.||.|||.
Human     1 MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKMEHT----NASFDTFFC 61

  Fly    55 ETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVL 119
            ||.||||||||:||||||||:|.:|||.:|.|||||||::||||||||||||.|::|.|::|:||
Human    62 ETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYSVGSEVIDLVL 126

  Fly   120 DRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEP 184
            :|.||||:||.||||||:|.||||||||||||||||||:.:|.:|:|||||:||||::|||||||
Human   127 ERTRKLAEQCGGLQGFLIFRSFGGGTGSGFTSLLMERLTGEYSRKTKLEFSVYPAPRISTAVVEP 191

  Fly   185 YNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYMNLNRLIGQIVSSITASLRFDGALN 249
            |||:||||:|.||:||.|||||||:||||.|.|.:|.|::.::|||:.|:||||||||||:|.||
Human   192 YNSVLTTHSTTEHTDCTFMVDNEAVYDICHRKLGVECPSHASINRLVVQVVSSITASLRFEGPLN 256

  Fly   250 VDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRRGKYMA 314
            |||.|||||||||||||||:..:||::|.:||||||.:|::||.||||.:||:||||||.|||||
Human   257 VDLIEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMA 321

  Fly   315 CCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379
            ||:|||||||||:||||||..|::.|:|||||||||||||||.:||||:||||||||.|::||||
Human   322 CCLLYRGDVVPKEVNAAIAATKSRHSVQFVDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLS 386

  Fly   380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALEKDYEEV 435
            |||||.|||||||||||||||||||:|||:.|||||.||.||||||||||:|||||
Human   387 NTTAIVEAWARLDHKFDLMYAKRAFLHWYLREGMEEAEFLEAREDLAALERDYEEV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub85ENP_524297.1 PTZ00335 1..448 CDD:185562 324/446 (73%)
TUBAL3NP_079079.1 alpha_tubulin 2..442 CDD:276955 321/443 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54134
OrthoDB 1 1.010 - - D275336at33208
OrthoFinder 1 1.000 - - FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100108
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.