DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub85E and TUBD1

DIOPT Version :9

Sequence 1:NP_524297.1 Gene:alphaTub85E / 41183 FlyBaseID:FBgn0003886 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_057345.2 Gene:TUBD1 / 51174 HGNCID:16811 Length:453 Species:Homo sapiens


Alignment Length:473 Identity:116/473 - (24%)
Similarity:202/473 - (42%) Gaps:71/473 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSDKTVGGGDDSFST-----FFSETGAGKHVPR 64
            ::|.:||.|.|||   :|::   ..:..|.|..........::::..     ||||...|..:.|
Human     4 VTVQLGQCGNQIG---FEVF---DALLSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPIAR 62

  Fly    65 AVFVDLEPTVVDEV-----RTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVLDRIRK 124
            ||.||:||.|::::     ::|.::  :........|:.:.||:|.|:...|....:.:::.|||
Human    63 AVLVDMEPKVINQMLSKAAQSGQWK--YGQHACFCQKQGSGNNWAYGYSVHGPRHEESIMNIIRK 125

  Fly   125 LADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSIL 189
            ..::|....||.:..|..||||||..:.:.:.|...|....|:...|:|. .....:|:.|||||
Human   126 EVEKCDSFSGFFIIMSMAGGTGSGLGAFVTQNLEDQYSNSLKMNQIIWPY-GTGEVIVQNYNSIL 189

  Fly   190 TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYMNLNRLIGQIVSSI-----TASLRFDGALN 249
            |.......||...:.:|:||:.||.:.::|::.::.::|:::...:.|:     :|...|....|
Human   190 TLSHLYRSSDALLLHENDAIHKICAKLMNIKQISFSDINQVLAHQLGSVFQPTYSAESSFHYRRN 254

  Fly   250 VDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAE---------ITNACFEPANQMVKC 305
             .|.:...:|||:|..........|.:|.....:...|.|.         |:||..|........
Human   255 -PLGDLMEHLVPHPEFKMLSVRNIPHMSENSLAYTTFTWAGLLKHLRQMLISNAKMEEGIDRHVW 318

  Fly   306 DPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKR--SIQFVDWCPTGFKVGINY----QPPTVVP 364
            .|..|......|....|:   ..|.:||.:...|  .:|..|  ..|||....|    :|   |.
Human   319 PPLSGLPPLSKMSLNKDL---HFNTSIANLVILRGKDVQSAD--VEGFKDPALYTSWLKP---VN 375

  Fly   365 GGDLAKVQRA-------VCMLSNT--------TAIAEAWARLDHKFDLMYAKRAFVHWYVGEGME 414
            ..::.|.|||       ..::||:        ..:.:||.        |:|.:|::|.|...|:|
Human   376 AFNVWKTQRAFSKYEKSAVLVSNSQFLVKPLDMIVGKAWN--------MFASKAYIHQYTKFGIE 432

  Fly   415 EGEFAEAREDLAALEKDY 432
            |.:|.::...|..:...|
Human   433 EEDFLDSFTSLEQVVASY 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub85ENP_524297.1 PTZ00335 1..448 CDD:185562 116/473 (25%)
TUBD1NP_057345.2 delta_zeta_tubulin-like 2..452 CDD:276958 116/473 (25%)
Tubulin 2..213 CDD:278518 60/217 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.