DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and foxp1b

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_005166112.1 Gene:foxp1b / 569047 ZFINID:ZDB-GENE-041203-1 Length:676 Species:Danio rerio


Alignment Length:320 Identity:152/320 - (47%)
Similarity:186/320 - (58%) Gaps:72/320 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 HPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQA 219
            |||:.||:|:|||||...||..||:||||.||.||||||||.|||||||.|||..|.|:::||||
Zfish   284 HPLYGHGVCKWPGCEAVFEDFQSFLKHLNNEHALDDRSTAQCRVQMQVVQQLELQLAKDKERLQA 348

  Fly   220 MMHHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSPS---PLNLP------- 274
            ||.||::......||                 |..:|.:........:|:   ||:||       
Zfish   349 MMTHLHVKSTEPKPT-----------------PQPLNLVSNVTLSKTAPAASPPLSLPQTPTTPT 396

  Fly   275 -----------MVNSTNLCS---IKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNA 325
                       ::..|:|.|   |::|..||               ..:.:..:|.:|:|||.||
Zfish   397 APLTPLSQTHSVITPTSLHSVGPIRRRYSDK---------------YNMPISPDIVQNKEFYMNA 446

  Fly   326 DVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYE 390
            :|||||||||||||||::||:||||||||||||...|.||||||||||.|:||||||||||||.|
Zfish   447 EVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKGAVRTNLSLHKCFVRVE 511

  Fly   391 DDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPTDKNPCDNCTQHCTSL 450
            |||||||.|||.||.:.||:.||||||:               ..|:| ||....|..:|
Zfish   512 DDFGSFWTVDDEEFKRGRHIQRGRPRKH---------------VADEN-CDQLLVHSPAL 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 45/66 (68%)
FH 328..400 CDD:238016 60/71 (85%)
foxp1bXP_005166112.1 FOXP-CC 286..353 CDD:318404 45/66 (68%)
FH 449..521 CDD:238016 60/71 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5255
eggNOG 1 0.900 - - E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001519
OrthoInspector 1 1.000 - - otm25338
orthoMCL 1 0.900 - - OOG6_103982
Panther 1 1.100 - - LDO PTHR45796
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4064
SonicParanoid 1 1.000 - - X957
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.