DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and Foxp2

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_002729331.1 Gene:Foxp2 / 500037 RGDID:1559697 Length:711 Species:Rattus norvegicus


Alignment Length:371 Identity:159/371 - (42%)
Similarity:202/371 - (54%) Gaps:75/371 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SYMHDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQL 206
            |..|:|....   |.|:.||:|:|||||...||...|:||||.||.||||||||.|||||||.||
  Rat   326 SSSHEETGAS---HTLYGHGVCKWPGCESICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQL 387

  Fly   207 ESHLQKERDRLQAMMHHLYLSK----------QLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRP 261
            |..|.|||:||||||.||::..          .|:|...:.:..:........::|.|..:...|
  Rat   388 EIQLSKERERLQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTP 452

  Fly   262 IRQTNSPS---PLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYK 323
            |  |..||   |.::|     |:.:|::|:.||               ..:.:..||..|.||||
  Rat   453 I--TQGPSVITPASVP-----NVGAIRRRHSDK---------------YNIPMSSEIAPNYEFYK 495

  Fly   324 NADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVR 388
            |||||||||||:||||||::|.|:||||||||:||..||.||||||||||||:|.||||||||||
  Rat   496 NADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVR 560

  Fly   389 YEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPT-DKN-PCDNCTQHCTSLP 451
            .|:..|:.|.||:.|:.|||                  .|...|.|| .|| |        |||.
  Rat   561 VENVKGAVWTVDEVEYQKRR------------------SQKITGSPTLVKNIP--------TSLG 599

  Fly   452 PGADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDYSNMDSGMIES 497
            .||  .|:::....|.. ..||...:.||      .:|..||::::
  Rat   600 YGA--ALNASLQAALAE-SSLPLLSNPGL------INNASSGLLQA 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 46/66 (70%)
FH 328..400 CDD:238016 53/71 (75%)
Foxp2XP_002729331.1 FOXP-CC 338..405 CDD:292777 46/66 (70%)
FH 500..572 CDD:238016 53/71 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5287
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001519
OrthoInspector 1 1.000 - - otm45502
orthoMCL 1 0.900 - - OOG6_103982
Panther 1 1.100 - - O PTHR45796
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X957
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.