DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and fd96Ca

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster


Alignment Length:221 Identity:57/221 - (25%)
Similarity:94/221 - (42%) Gaps:70/221 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 NREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSL 382
            :||.|  .:.:||::|.||...||..||:|.|.|::||.:..:.|.|:|:|...|:|::|.|||.
  Fly     5 SRESY--GEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSF 67

  Fly   383 HKCFVRY-----EDDFGSFW--------MVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVP 434
            :.||::.     ....|::|        |.::...::||       ::::               
  Fly    68 NDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRR-------KRFK--------------- 110

  Fly   435 TDKNPCDNCTQHCTSLP----------PGAD----NPLDSNN----------------PNDLGRI 469
            ..||..|...:..|:|.          .|..    :|||.||                ||.||..
  Fly   111 LHKNDKDLLNEELTALANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPG 175

  Fly   470 GCLPYCGSDGLSKASKDYSNM-DSGM 494
            ..||:.....:|.|  |::|: |.|:
  Fly   176 VPLPHVMPASMSGA--DHTNLADMGL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 29/84 (35%)
fd96CaNP_001287516.1 FH 13..101 CDD:214627 29/87 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.